Ly6e, Recombinant, Mouse, aa21-102, His-SUMO-Tag (Lymphocyte Antigen 6E)

Involved in T-cell development. Source: Recombinant protein corresponding to aa21-102 from mouse Lymphocyte Antigen 6E, fused to His-SUMO-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~24.8kD, AA Sequence: LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.