- Suchergebnis für Q64253
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "Q64253" wurden 18 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: TGM-TMPH-02767-10ug
Description: LY6E Protein, Mouse, Recombinant (His & SUMO) is expressed in yeast with N-6xHis-SUMO tag. The predicted molecular weight is 24.8 kDa and the accession number is Q64253.
| Schlagworte: | Tsa-1 , Ly-6E , Ly67 , Sca-2 , Lymphocyte antigen 6E , Ly6e , Thymic shared antigen 1 (TSA-1) , Stem cell antigen 2 |
| MW: | 24.8 kD |
ab 115,00 €
Artikelnummer: TGM-TMPH-04292-100ug
Description: LY6E Protein, Mouse, Recombinant (His) is expressed in E. coli with N-6xHis. The accession number is Q64253.
| Schlagworte: | Thymic shared antigen 1 (TSA-1) , Ly6e , Ly67 , Lymphocyte antigen 6E , Tsa-1 , Sca-2 , Stem cell antigen 2 , Ly-6E |
| MW: | 12.9 kD |
ab 93,00 €
Artikelnummer: ARG65280.100
Protein function: Involved in T-cell development. [The UniProt Consortium]
| Schlagworte: | Anti-Ly67, Anti-Ly6e, Anti-Ly-6E, Anti-TSA-1, Anti-Stem cell antigen 2, Anti-Lymphocyte antigen 6E, Anti-Thymic shared... |
| Anwendung: | ELISA, IHC (paraffin) |
| Wirt: | Goat |
| Spezies-Reaktivität: | mouse |
871,00 €
Artikelnummer: G-PACO36374.50
Ly6e Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Mouse, Human and for use in ELISA, WB applications. Ly6e Antibody is a high quality polyclonal antibody for research use only.. Protein function: GPI-anchored cell surface protein that regulates T- lymphocytes proliferation,...
| Schlagworte: | Anti-Ly67, Anti-TSA-1, Anti-Ly-6E, Anti-Stem cell antigen 2, Anti-Lymphocyte antigen 6E, Anti-Thymic shared antigen 1 |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | mouse, human |
313,00 €
Artikelnummer: CSB-YP717533MO.1
Organism: Mus musculus (Mouse). Source: Yeast. Expression Region: 27-108aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: LMCFSCTDQK NNINCLWPVS CQEKDHYCIT LSAAAGFGNV NLGYTLNKGC SPICPSENVN LNLGVASVNS YCCQSSFCNF SA. Purity: Greater than 90% as...
| Schlagworte: | Ly67, TSA-1, Ly-6E, Stem cell antigen 2, Lymphocyte antigen 6E, Thymic shared antigen 1, Recombinant Mouse Lymphocyte... |
| Anwendung: | Activity not tested |
| Exprimiert in: | Yeast |
| Ursprungsart: | mouse |
| MW: | 24.8 kD |
ab 347,00 €
Artikelnummer: CSB-EP717533MO.1
Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 27-108aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-B2M-tagged. Target Protein Sequence: LMCFSCTDQK NNINCLWPVS CQEKDHYCIT LSAAAGFGNV NLGYTLNKGC SPICPSENVN LNLGVASVNS YCCQSSFCNF SA. Purity: Greater than 90% as...
| Schlagworte: | Ly67, TSA-1, Ly-6E, Stem cell antigen 2, Lymphocyte antigen 6E, Thymic shared antigen 1, Recombinant Mouse Lymphocyte... |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | mouse |
| MW: | 22.8 kD |
ab 292,00 €
Artikelnummer: CSB-EP717533MOa0.1
Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 27-108aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: LMCFSCTDQK NNINCLWPVS CQEKDHYCIT LSAAAGFGNV NLGYTLNKGC SPICPSENVN LNLGVASVNS YCCQSSFCNF SA. Purity: Greater than 95% as determined by...
| Schlagworte: | Ly67, TSA-1, Ly-6E, Stem cell antigen 2, Lymphocyte antigen 6E, Thymic shared antigen 1, Recombinant Mouse Lymphocyte... |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | mouse |
| MW: | 12.9 kD |
ab 292,00 €
Artikelnummer: CSB-EP717533MOb1.1
Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 27-108aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Target Protein Sequence: LMCFSCTDQK NNINCLWPVS CQEKDHYCIT LSAAAGFGNV NLGYTLNKGC SPICPSENVN LNLGVASVNS YCCQSSFCNF SA. Purity:...
| Schlagworte: | Ly67, TSA-1, Ly-6E, Stem cell antigen 2, Lymphocyte antigen 6E, Thymic shared antigen 1, Recombinant Mouse Lymphocyte... |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | mouse |
| MW: | 13.8 kD |
ab 292,00 €
Artikelnummer: TGM-TMPH-02766-100ug
Description: LY6E Protein, Mouse, Recombinant (B2M & His) is expressed in E. coli.
| Schlagworte: | Lymphocyte antigen 6E, Ly6e, Thymic shared antigen 1, Stem cell antigen 2 |
| MW: | 22.8 kD |
ab 266,00 €
Artikelnummer: TGM-TMPH-02767-100ug
Description: LY6E Protein, Mouse, Recombinant (His & SUMO) is expressed in yeast with N-6xHis-SUMO tag. The predicted molecular weight is 24.8 kDa and the accession number is Q64253.
| Schlagworte: | Ly6e, Stem cell antigen 2, Thymic shared antigen 1, Lymphocyte antigen 6E |
| MW: | 24.8 kD |
ab 320,00 €
Artikelnummer: TGM-TMPH-02766-10ug
Description: LY6E Protein, Mouse, Recombinant (B2M & His) is expressed in E. coli.
| Schlagworte: | Ly67 , Ly-6E , Sca-2 , Tsa-1 , Ly6e , Lymphocyte antigen 6E , Thymic shared antigen 1 (TSA-1) , Stem cell antigen 2 |
| MW: | 22.8 kD |
ab 99,00 €
Artikelnummer: 374096.100
Involved in T-cell development. Source: Recombinant protein corresponding to aa21-102 from mouse Ly6e, fused to His-B2M-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~22.8kD, AA Sequence: LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA, Storage and Stability: May be...
| Schlagworte: | Ly67, Ly6e, TSA-1, Ly-6E, Stem cell antigen 2, Lymphocyte antigen 6E, Thymic shared antigen 1 |
| MW: | 22,8 |
ab 690,00 €