Zu "Q64253" wurden 5 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-LY6E, Internal
Artikelnummer: ARG65280.100
Protein function: Involved in T-cell development. [The UniProt Consortium]
| Schlagworte: | Anti-Ly67, Anti-Ly6e, Anti-Ly-6E, Anti-TSA-1, Anti-Stem cell antigen 2, Anti-Lymphocyte antigen 6E, Anti-Thymic shared... |
| Anwendung: | ELISA, IHC (paraffin) |
| Wirt: | Goat |
| Spezies-Reaktivität: | mouse |
784,00 €
Anti-Ly6e
Artikelnummer: G-PACO36374.50
Ly6e Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Mouse, Human and for use in ELISA, WB applications. Ly6e Antibody is a high quality polyclonal antibody for research use only.. Protein function: GPI-anchored cell surface protein that regulates T- lymphocytes proliferation,...
| Schlagworte: | Anti-Ly67, Anti-TSA-1, Anti-Ly-6E, Anti-Stem cell antigen 2, Anti-Lymphocyte antigen 6E, Anti-Thymic shared antigen 1 |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | mouse, human |
363,00 €
Ly6E, Mouse lymphocyte antigen 6 complex, locus E, Real...
Artikelnummer: VMPS-3611
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | Ly6e, Ly67, TSA-1, Ly-6E, Stem cell antigen 2, Lymphocyte antigen 6E, Thymic shared antigen 1 |
| Anwendung: | RNA quantification |
43,00 €
Ly6e, Recombinant, Mouse, aa21-102, His-B2M-Tag...
Artikelnummer: 374096.100
Involved in T-cell development. Source: Recombinant protein corresponding to aa21-102 from mouse Ly6e, fused to His-B2M-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~22.8kD, AA Sequence: LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA, Storage and Stability: May be...
| Schlagworte: | Ly67, Ly6e, TSA-1, Ly-6E, Stem cell antigen 2, Lymphocyte antigen 6E, Thymic shared antigen 1 |
| MW: | 22,8 |
ab 575,00 €
Ly6e, Recombinant, Mouse, aa21-102, His-SUMO-Tag...
Artikelnummer: 374097.100
Involved in T-cell development. Source: Recombinant protein corresponding to aa21-102 from mouse Lymphocyte Antigen 6E, fused to His-SUMO-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~24.8kD, AA Sequence: LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA, Storage and...
| Schlagworte: | Ly67, Ly6e, TSA-1, Ly-6E, Stem cell antigen 2, Lymphocyte antigen 6E, Thymic shared antigen 1 |
| MW: | 24,8 |
ab 497,00 €
