LIPA, Recombinant, Human, aa22-399, His-Tag (Lysosomal Acid Lipase/Cholesteryl Ester Hydrolase)

LIPA, Recombinant, Human, aa22-399, His-Tag (Lysosomal Acid Lipase/Cholesteryl Ester Hydrolase)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374050.20 20 µg - -

3 - 19 Werktage*

531,00 €
374050.100 100 µg - -

3 - 19 Werktage*

773,00 €
 
Crucial for the intracellular hydrolysis of cholesteryl esters and triglycerides that have been... mehr
Produktinformationen "LIPA, Recombinant, Human, aa22-399, His-Tag (Lysosomal Acid Lipase/Cholesteryl Ester Hydrolase)"
Crucial for the intracellular hydrolysis of cholesteryl esters and triglycerides that have been internalized via receptor-mediated endocytosis of lipoprotein particles. Important in mediating the effect of LDL (low density lipoprotein) uptake on suppression of hydroxymethylglutaryl-CoA reductase and activation of endogenous cellular cholesteryl ester formation. Source: Recombinant protein corresponding to aa22-399 from human LIPA, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~45.0kD, AA Sequence: SGGKLTAVDPETNMNVSEIISYWGFPSEEYLVETEDGYILCLNRIPHGRKNHSDKGPKPVVFLQHGLLADSSNWVTNLANSSLGFILADAGFDVWMGNSRGNTWSRKHKTLSVSQDEFWAFSYDEMAKYDLPASINFILNKTGQEQVYYVGHSQGTTIGFIAFSQIPELAKRIKMFFALGPVASVAFCTSPMAKLGRLPDHLIKDLFGDKEFLPQSAFLKWLGTHVCTHVILKELCGNLCFLLCGFNERNLNMSRVDVYTTHSPAGTSVQNMLHWSQAVKFQKFQAFDWGSSAKNYFHYNQSYPPTYNVKDMLVPTAVWSGGHDWLADVYDVNILLTQITNLVFHESIPEWEHLDFIWGLDAPWRLYNKIINLMRKYQ, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: LAL, LIPA, Lipase A, EC=3.1.1.13, Sterol esterase, Cholesteryl esterase, Acid cholesteryl ester hydrolase, Lysosomal acid lipase/cholesteryl ester hydrolase
Hersteller: United States Biological
Hersteller-Nr: 374050

Eigenschaften

Konjugat: No
MW: 45
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "LIPA, Recombinant, Human, aa22-399, His-Tag (Lysosomal Acid Lipase/Cholesteryl Ester Hydrolase)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen