Glutaminyl-peptide Cyclotransferase, Recombinant, Human, aa29-361, His-SUMO-Tag (QPCT)

Glutaminyl-peptide Cyclotransferase, Recombinant, Human, aa29-361, His-SUMO-Tag (QPCT)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
370631.20 20 µg - -

3 - 19 Werktage*

511,00 €
370631.100 100 µg - -

3 - 19 Werktage*

773,00 €
 
Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and... mehr
Produktinformationen "Glutaminyl-peptide Cyclotransferase, Recombinant, Human, aa29-361, His-SUMO-Tag (QPCT)"
Responsible for the biosynthesis of pyroglutamyl peptides. Has a bias against acidic and tryptophan residues adjacent to the N-terminal glutaminyl residue and a lack of importance of chain length after the second residue. Also catalyzes N-terminal pyroglutamate formation. In vitro, catalyzes pyroglutamate formation of N-terminally truncated form of APP amyloid-beta peptides [Glu-3]-beta-amyloid. May be involved in the N-terminal pyroglutamate formation of several amyloid-related plaque-forming peptides. Source: Recombinant protein corresponding to aa29-361 from human QPCT, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~53.9kD, AA Sequence: VSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL, , Storag
Schlagworte: QC, EC, sQC, QPCT, EC=2.3.2.5, Glutamyl cyclase, Glutaminyl cyclase, Glutaminyl-tRNA cyclotransferase, Glutaminyl-peptide cyclotransferase
Hersteller: United States Biological
Hersteller-Nr: 370631

Eigenschaften

Konjugat: No
MW: 53,9
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Glutaminyl-peptide Cyclotransferase, Recombinant, Human, aa29-361, His-SUMO-Tag (QPCT)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen