BAZ2B, Recombinant, Human, aa2054-2168, His-Tag (Bromodomain Adjacent to Zinc Finger Domain 2B)

BAZ2B (Bromodomain Adjacent To Zinc Finger Domain, 2B) is a Protein Coding gene. Source: Recombinant protein corresponding to aa2054-2168 from human BAZ2B, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~14.3kD, AA Sequence: MHHHHHHSVKKPKRDDSKDLALCSMILTEMETHEDAWPFLLPVNLKLVPGYKKVIKKP, MDFSTIREKLSSGQYPNLETFALDVRLVFDNCETFNEDDSDIGRAGHNMRKYFEKKWT, DTFKVS, Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.