Zu "Q9UIF8" wurden 11 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-BAZ2B, C-terminal
Artikelnummer: ARG63649.100
Protein function: May play a role in transcriptional regulation interacting with ISWI. [The UniProt Consortium]
| Schlagworte: | Anti-BAZ2B, Anti-hWALp4, Anti-KIAA1476, Anti-Bromodomain adjacent to zinc finger domain protein 2B |
| Anwendung: | ELISA, IHC (paraffin) |
| Wirt: | Goat |
| Spezies-Reaktivität: | human |
784,00 €
BAZ2B (2054-2168), human recombinant protein, N-terminal...
Artikelnummer: BPS-31113
Human Bromodomain adjacent to zinc finger domain, 2B or BAZ2B, amino-acids 2054 ? 2168 (end), GenBank Accession No. NM_013450 with N-terminal HIS-tag, MW = 14.3 kDa, expressed in an E. coli expression system.
| Schlagworte: | BAZ2B, hWALp4, KIAA1476, Bromodomain adjacent to zinc finger domain protein 2B, |
| Anwendung: | BRD binding assays, inhibitor screening, selectivity profiling |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 15.1 kD |
452,00 €
BAZ2B Inhibitor Screening Assay Kit
Artikelnummer: BPS-32600
The BAZ2B Inhibitor Screening Assay Kit is designed to measure the inhibition of BAZ2B bromodomain binding to its substrate. The kit comes in a convenient AlphaLISA(R) format, with biotinylated histone peptide substrate, assay buffer, detection buffer and purified BAZ2B for 384 assays.
| Schlagworte: | BAZ2B, hWALp4, KIAA1476, Bromodomain adjacent to zinc finger domain protein 2B |
| Anwendung: | BAZ2B iInhibitor screening |
752,00 €
Anti-BAZ2B
Artikelnummer: NSJ-R36365-100UG
0.5 mg/ml in 1X TBS, pH7.3, with 0.5% BSA (US sourced) and 0.02% sodium azide. Additional name(s) for this target protein: Bromodomain adjacent to zinc finger domain, 2B Protein function: May play a role in transcriptional regulation interacting with ISWI. [The UniProt Consortium]
| Schlagworte: | Anti-BAZ2B, Anti-hWALp4, Anti-KIAA1476, Anti-Bromodomain adjacent to zinc finger domain protein 2B, BAZ2B Antibody |
| Anwendung: | IHC, ELISA (peptide) |
| Wirt: | Goat |
| Spezies-Reaktivität: | human |
755,00 €
Anti-BAZ2B
Artikelnummer: G-PACO57536.50
BAZ2B Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC, IF applications. BAZ2B Antibody is a high quality polyclonal antibody for research use only.. Protein function: May play a role in transcriptional regulation interacting with ISWI. [The UniProt...
| Schlagworte: | Anti-BAZ2B, Anti-hWALp4, Anti-KIAA1476, Anti-Bromodomain adjacent to zinc finger domain protein 2B |
| Anwendung: | ELISA, IHC, IF |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
363,00 €
Anti-BAZ2B
Artikelnummer: ATA-HPA019819.100
Protein function: May play a role in transcriptional regulation interacting with ISWI. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 75% and to rat: 75%
| Schlagworte: | Anti-BAZ2B, Anti-hWALp4, Anti-KIAA1476, Anti-Bromodomain adjacent to zinc finger domain protein 2B |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 335,00 €
Anti-BAZ2B
Artikelnummer: ATA-HPA059292.100
Protein function: May play a role in transcriptional regulation interacting with ISWI. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 91% and to rat: 89%
| Schlagworte: | Anti-BAZ2B, Anti-hWALp4, Anti-KIAA1476, Anti-Bromodomain adjacent to zinc finger domain protein 2B |
| Anwendung: | ICC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 335,00 €
H3 Positive Control
Artikelnummer: Cay600506-12.5
Formulation: A lyophilized powder.
| Anwendung: | Kit component |
ab 34,00 €
BAZ2B, Recombinant, Human, aa2054-2168, His-Tag...
Artikelnummer: 298333.100
BAZ2B (Bromodomain Adjacent To Zinc Finger Domain, 2B) is a Protein Coding gene. Source: Recombinant protein corresponding to aa2054-2168 from human BAZ2B, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~14.3kD, AA Sequence: MHHHHHHSVKKPKRDDSKDLALCSMILTEMETHEDAWPFLLPVNLKLVPGYKKVIKKP,...
| Schlagworte: | BAZ2B, hWALp4, KIAA1476, Bromodomain adjacent to zinc finger domain protein 2B |
| MW: | 14,3 |
916,00 €
BAZ2B PrEST Antigen
Artikelnummer: ATA-APrEST73703.100
Protein function: May play a role in transcriptional regulation interacting with ISWI. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | BAZ2B, hWALp4, KIAA1476, Bromodomain adjacent to zinc finger domain protein 2B |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
247,00 €
BAZ2B PrEST Antigen
Artikelnummer: ATA-APrEST91988.100
Protein function: May play a role in transcriptional regulation interacting with ISWI. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Schlagworte: | BAZ2B, hWALp4, KIAA1476, Bromodomain adjacent to zinc finger domain protein 2B |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
247,00 €