Amyloid Protein A, Recombinant, Feline, aa1-90, His-B2M-Tag (SAA1)

Major acute phase reactant. Apolipoprotein of the HDL complex. Source: Recombinant protein corresponding to aa1-90 from feline SAA1, fused to His-B2M-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~26.1kD, AA Sequence: EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRVTDFFRHGNSGHGAEDSKADQEWG, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.