- Suchergebnis für P19707
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "P19707" wurden 10 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: TGM-TMPH-00357-10ug
Description: Major acute phase reactant. Apolipoprotein of the HDL complex. SAA1 Protein, Feline, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 12.1 kDa and the accession number is P19707.
| Schlagworte: | Serum amyloid A protein , SAA1 , SAA |
| MW: | 12.1 kD |
ab 134,00 €
Artikelnummer: CSB-YP020656CA.1
Organism: Felis catus (Cat) (Felis silvestris catus). Source: Yeast. Expression Region: 1-90aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: EWYSFLGEAA QGAWDMWRAY SDMREANYIG ADKYFHARGN YDAAQRGPGG AWAAKVISDA RENSQRVTDF FRHGNSGHGA EDSKADQEWG. Purity: Greater than 90% as...
| Schlagworte: | SAA1, Recombinant Cat Serum amyloid A protein (SAA1), partial |
| Anwendung: | Activity not tested |
| Exprimiert in: | Yeast |
| Ursprungsart: | cat |
| MW: | 12.1 kD |
ab 407,00 €
Artikelnummer: CSB-EP020656CA.1
Organism: Felis catus (Cat) (Felis silvestris catus). Source: E.coli. Expression Region: 1-90aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-B2M-tagged. Target Protein Sequence: EWYSFLGEAA QGAWDMWRAY SDMREANYIG ADKYFHARGN YDAAQRGPGG AWAAKVISDA RENSQRVTDF FRHGNSGHGA EDSKADQEWG. Purity: Greater than 90% as...
| Schlagworte: | SAA1, Recombinant Cat Serum amyloid A protein (SAA1), partial |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | cat |
| MW: | 24.1 kD |
ab 364,00 €
Artikelnummer: TGM-TMPH-00357-100ug
Description: Major acute phase reactant. Apolipoprotein of the HDL complex. SAA1 Protein, Feline, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 12.1 kDa and the accession number is P19707.
| Schlagworte: | Serum amyloid A protein, SAA1 |
| MW: | 12.1 kD |
ab 375,00 €
Artikelnummer: TGM-TMPH-00358-100ug
Description: Major acute phase reactant. Apolipoprotein of the HDL complex. SAA1 Protein, Feline, Recombinant (B2M & His) is expressed in E. coli expression system with N-6xHis-B2M tag. The predicted molecular weight is 24.1 kDa and the accession number is P19707.
| Schlagworte: | SAA1, Serum amyloid A protein |
| MW: | 24.1 kD |
ab 340,00 €
Artikelnummer: TGM-TMPH-00358-10ug
Description: Major acute phase reactant. Apolipoprotein of the HDL complex. SAA1 Protein, Feline, Recombinant (B2M & His) is expressed in E. coli expression system with N-6xHis-B2M tag. The predicted molecular weight is 24.1 kDa and the accession number is P19707.
| Schlagworte: | SAA1 , SAA , Serum amyloid A protein |
| MW: | 24.1 kD |
ab 122,00 €
Artikelnummer: 516100.100
Recombinant protein corresponding to aa1-111 from feline Amyloid A Serum (SAA), fused to a 10aa His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~13.8kD (Theoretical), Applications: Suitable for use in ELISA. May be used as a Control. Other applications not tested. Recommended Dilution: Optimal...
| Schlagworte: | SAA1 |
| Anwendung: | ELISA, Control |
| Ursprungsart: | cat |
| MW: | 13.8 kD |
1.270,00 €
Artikelnummer: 375188.100
Major acute phase reactant. Apolipoprotein of the HDL complex. Source: Recombinant protein corresponding to aa1-90 from feline SAA1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~12.1kD, AA Sequence: EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRVTDFFRHGNSGHGAEDSKADQEWG,...
| Schlagworte: | SAA1 |
| MW: | 12,1 |
ab 707,00 €
Artikelnummer: 370519.100
Major acute phase reactant. Apolipoprotein of the HDL complex. Source: Recombinant protein corresponding to aa1-90 from feline SAA1, fused to His-B2M-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~26.1kD, AA Sequence:...
| Schlagworte: | SAA1 |
| MW: | 26,1 |
ab 786,00 €
Artikelnummer: CSB-PA020656ZA01CA.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-SAA1, SAA1 Antibody |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Felis catus (Cat) (Felis silvestris catus) |
ab 1.529,00 €