Zu "P19707" wurden 3 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Amyloid A Serum (SAA), Recombinant, Feline, aa1-111, His-Tag
Artikelnummer: 516100.100
Recombinant protein corresponding to aa1-111 from feline Amyloid A Serum (SAA), fused to a 10aa His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~13.8kD (Theoretical), Applications: Suitable for use in ELISA. May be used as a Control. Other applications not tested. Recommended Dilution: Optimal...
| Schlagworte: | SAA1 |
| Anwendung: | ELISA, Control |
| Ursprungsart: | cat |
| MW: | 13.8 kD |
1.137,00 €
SAA1, Recombinant, Feline, aa1-90, His-Tag (Amyloid...
Artikelnummer: 375188.100
Major acute phase reactant. Apolipoprotein of the HDL complex. Source: Recombinant protein corresponding to aa1-90 from feline SAA1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~12.1kD, AA Sequence: EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRVTDFFRHGNSGHGAEDSKADQEWG,...
| Schlagworte: | SAA1 |
| MW: | 12,1 |
ab 675,00 €
Amyloid Protein A, Recombinant, Feline, aa1-90,...
Artikelnummer: 370519.100
Major acute phase reactant. Apolipoprotein of the HDL complex. Source: Recombinant protein corresponding to aa1-90 from feline SAA1, fused to His-B2M-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~26.1kD, AA Sequence:...
| Schlagworte: | SAA1 |
| MW: | 26,1 |
ab 636,00 €
