Zu "P19707" wurden 10 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
SAA1 Protein, Feline, Recombinant (His)
Artikelnummer: TGM-TMPH-00357-10ug
Description: Major acute phase reactant. Apolipoprotein of the HDL complex. SAA1 Protein, Feline, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 12.1 kDa and the accession number is P19707.
| Schlagworte: | Serum amyloid A protein , SAA1 , SAA |
| MW: | 12.1 kD |
ab 134,00 €
Serum amyloid A protein (SAA1), partial, cat, recombinant
Artikelnummer: CSB-YP020656CA.1
Organism: Felis catus (Cat) (Felis silvestris catus). Source: Yeast. Expression Region: 1-90aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: EWYSFLGEAA QGAWDMWRAY SDMREANYIG ADKYFHARGN YDAAQRGPGG AWAAKVISDA RENSQRVTDF FRHGNSGHGA EDSKADQEWG. Purity: Greater than 90% as...
| Schlagworte: | SAA1, Recombinant Cat Serum amyloid A protein (SAA1), partial |
| Anwendung: | Activity not tested |
| Exprimiert in: | Yeast |
| Ursprungsart: | cat |
| MW: | 12.1 kD |
ab 407,00 €
Serum amyloid A protein (SAA1), partial, cat, recombinant
Artikelnummer: CSB-EP020656CA.1
Organism: Felis catus (Cat) (Felis silvestris catus). Source: E.coli. Expression Region: 1-90aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-B2M-tagged. Target Protein Sequence: EWYSFLGEAA QGAWDMWRAY SDMREANYIG ADKYFHARGN YDAAQRGPGG AWAAKVISDA RENSQRVTDF FRHGNSGHGA EDSKADQEWG. Purity: Greater than 90% as...
| Schlagworte: | SAA1, Recombinant Cat Serum amyloid A protein (SAA1), partial |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | cat |
| MW: | 24.1 kD |
ab 364,00 €
SAA1 Protein, Feline, Recombinant (His)
Artikelnummer: TGM-TMPH-00357-100ug
Description: Major acute phase reactant. Apolipoprotein of the HDL complex. SAA1 Protein, Feline, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 12.1 kDa and the accession number is P19707.
| Schlagworte: | Serum amyloid A protein, SAA1 |
| MW: | 12.1 kD |
ab 375,00 €
SAA1 Protein, Feline, Recombinant (B2M & His)
Artikelnummer: TGM-TMPH-00358-100ug
Description: Major acute phase reactant. Apolipoprotein of the HDL complex. SAA1 Protein, Feline, Recombinant (B2M & His) is expressed in E. coli expression system with N-6xHis-B2M tag. The predicted molecular weight is 24.1 kDa and the accession number is P19707.
| Schlagworte: | SAA1, Serum amyloid A protein |
| MW: | 24.1 kD |
ab 340,00 €
SAA1 Protein, Feline, Recombinant (B2M & His)
Artikelnummer: TGM-TMPH-00358-10ug
Description: Major acute phase reactant. Apolipoprotein of the HDL complex. SAA1 Protein, Feline, Recombinant (B2M & His) is expressed in E. coli expression system with N-6xHis-B2M tag. The predicted molecular weight is 24.1 kDa and the accession number is P19707.
| Schlagworte: | SAA1 , SAA , Serum amyloid A protein |
| MW: | 24.1 kD |
ab 122,00 €
Amyloid A Serum (SAA), Recombinant, Feline, aa1-111, His-Tag
Artikelnummer: 516100.100
Recombinant protein corresponding to aa1-111 from feline Amyloid A Serum (SAA), fused to a 10aa His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~13.8kD (Theoretical), Applications: Suitable for use in ELISA. May be used as a Control. Other applications not tested. Recommended Dilution: Optimal...
| Schlagworte: | SAA1 |
| Anwendung: | ELISA, Control |
| Ursprungsart: | cat |
| MW: | 13.8 kD |
1.270,00 €
SAA1, Recombinant, Feline, aa1-90, His-Tag (Amyloid...
Artikelnummer: 375188.100
Major acute phase reactant. Apolipoprotein of the HDL complex. Source: Recombinant protein corresponding to aa1-90 from feline SAA1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~12.1kD, AA Sequence: EWYSFLGEAAQGAWDMWRAYSDMREANYIGADKYFHARGNYDAAQRGPGGAWAAKVISDARENSQRVTDFFRHGNSGHGAEDSKADQEWG,...
| Schlagworte: | SAA1 |
| MW: | 12,1 |
ab 707,00 €
Amyloid Protein A, Recombinant, Feline, aa1-90,...
Artikelnummer: 370519.100
Major acute phase reactant. Apolipoprotein of the HDL complex. Source: Recombinant protein corresponding to aa1-90 from feline SAA1, fused to His-B2M-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~26.1kD, AA Sequence:...
| Schlagworte: | SAA1 |
| MW: | 26,1 |
ab 786,00 €
Anti-SAA1
Artikelnummer: CSB-PA020656ZA01CA.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Schlagworte: | Anti-SAA1, SAA1 Antibody |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Felis catus (Cat) (Felis silvestris catus) |
ab 1.529,00 €