Anti-HDAC6

Anti-HDAC6
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
NSJ-R32342 100 µg - -

3 - 10 Werktage*

772,00 €
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. HDAC6, also called KIAA0901, is a member... mehr
Produktinformationen "Anti-HDAC6"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. HDAC6, also called KIAA0901, is a member belongs to class II of the histone deacetylase/acuc/apha family of proteins that is an enzyme that in humans is encoded by the HDAC6 gene. The HDAC6 gene is mapped to chromosome Xp11.23. HDAC6 contains an internal duplication of two catalytic domains which appear to function independently of each other. The protein possesses histone deacetylase activity and represses transcription. HDAC6 functions as a tubulin deacetylase. And it is localized exclusively in the cytoplasm, where it associates with microtubules and localizes with the microtubule motor complex. HDAC6 could bind both polyubiquitinated misfolded proteins and dynein motors, thereby recruiting misfolded protein cargo to dynein motors for transport to aggresomes. Furthermore, expression of HDAC6 was sufficient to rescue degeneration associated with UPS dysfunction in vivo in an autophagy-dependent manner. HDAC6 is a central component of the stress response that regulates SG formation and potentially contributes to control of RNA metabolism and translation. Protein function: Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4) (PubMed:10220385). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events (PubMed:10220385). Histone deacetylases act via the formation of large multiprotein complexes (PubMed:10220385). In addition to histones, deacetylates other proteins, such as CTTN, tubulin and SQSTM1 (PubMed:12024216, PubMed:20308065, PubMed:26246421, PubMed:30538141, PubMed:31857589). Plays a central role in microtubule-dependent cell motility by mediating deacetylation of tubulin (PubMed:12024216, PubMed:20308065, PubMed:26246421). Required for cilia disassembly, via deacetylation of alpha-tubulin (PubMed:17604723, PubMed:26246421). Promotes deacetylation of CTTN, leading to actin polymerization, promotion of autophagosome-lysosome fusion and completion of autophagy (PubMed:30538141). Involved in the MTA1-mediated epigenetic regulation of ESR1 expression in breast cancer (PubMed:24413532). Promotes odontoblast differentiation following IPO7-mediated nuclear import and subsequent repression of RUNX2 expression. In addition to its protein deacetylase activity, plays a key role in the degradation of misfolded proteins: when misfolded proteins are too abundant to be degraded by the chaperone refolding system and the ubiquitin-proteasome, mediates the transport of misfolded proteins to a cytoplasmic juxtanuclear structure called aggresome (PubMed:17846173). Probably acts as an adapter that recognizes polyubiquitinated misfolded proteins and target them to the aggresome, facilitating their clearance by autophagy (PubMed:17846173). [The UniProt Consortium]
Schlagworte: Anti-HD6, Anti-JM21, Anti-Histone deacetylase 6, Anti-Protein deacetylase HDAC6, Anti-Tubulin-lysine deacetylase HDAC6, HDAC6 Antibody
Hersteller: NSJ Bioreagents
Hersteller-Nr: R32342

Eigenschaften

Anwendung: WB, FC
Antikörper-Typ: Polyclonal
Konjugat: No
Wirt: Rabbit
Spezies-Reaktivität: human, mouse, rat
Immunogen: Amino acids EKEELMLVHSLEYIDLMETTQYMNEGELRVLAD of human HDAC6
Format: Purified

Handhabung & Sicherheit

Lagerung: +4°C
Versand: +4°C (International: -20°C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Anti-HDAC6"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen