- Suchergebnis für Q9BYC9
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "Q9BYC9" wurden 10 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: E-AB-18777.120
MRPL20 is one of more than 70 protein components of mitochondrial ribosomes that are encoded by the nuclear genome. MRPL20 is a subunit of the 39S mitochondrial ribosome. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA...
Schlagworte: | Anti-L20mt, Anti-MRPL20, Anti-MRP-L20, Anti-39S ribosomal protein L20, mitochondrial, Anti-Mitochondrial large ribosomal... |
Anwendung: | WB, IHC, ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse |
ab 71,00 €
Artikelnummer: G-PACO01095.50
MRPL20 Antibody from Assay Genie with reactivity against Human, Mouse, Rat and for use in ELISA, WB, IHC applications. MRPL20 Antibody is Polyclonal and is a IgG isotype antibody from Assay Genie.
Schlagworte: | Anti-L20mt, Anti-MRPL20, Anti-MRP-L20, Anti-39S ribosomal protein L20, mitochondrial, Anti-Mitochondrial large ribosomal... |
Anwendung: | ELISA, WB, IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
320,00 €
Artikelnummer: G-PACO22089.100
MRPL20 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse, Rat and for use in ELISA, WB applications. MRPL20 Antibody is a high quality polyclonal antibody for research use only.
Schlagworte: | Anti-L20mt, Anti-MRPL20, Anti-MRP-L20, Anti-39S ribosomal protein L20, mitochondrial, Anti-Mitochondrial large ribosomal... |
Anwendung: | ELISA, WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
448,00 €
Artikelnummer: G-PACO40510.50
MRPL20 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC applications. MRPL20 Antibody is a high quality polyclonal antibody for research use only.
Schlagworte: | Anti-L20mt, Anti-MRPL20, Anti-MRP-L20, Anti-39S ribosomal protein L20, mitochondrial, Anti-Mitochondrial large ribosomal... |
Anwendung: | ELISA, IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
363,00 €
Artikelnummer: ATA-HPA047074.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 91% and to rat: 91%
Schlagworte: | Anti-L20mt, Anti-MRPL20, Anti-MRP-L20, Anti-39S ribosomal protein L20, mitochondrial, Anti-Mitochondrial large ribosomal... |
Anwendung: | ICC, IHC, WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 335,00 €
Artikelnummer: ELK-ES2834.100
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes,...
Schlagworte: | Anti-L20mt, Anti-MRPL20, Anti-MRP-L20, Anti-Large ribosomal subunit protein bL20m, Anti-39S ribosomal protein L20,... |
Anwendung: | WB, IHC, IF, ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
ab 169,00 €
Artikelnummer: VHPS-5835
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Schlagworte: | L20mt, MRPL20, MRP-L20, 39S ribosomal protein L20, mitochondrial |
Anwendung: | RNA quantification |
43,00 €
Artikelnummer: 374269.100
Source:, Recombinant protein corresponding to aa46-149 from human MRPL20, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.8kD, AA Sequence: VIRAFVKCTKARYLKKKNMRTLWINRITAASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYEPKTFKSLAALASRRRHEGFAAALGDGKEPEGIFSRVVQYH, Storage and Stability: May be stored...
Schlagworte: | L20mt, MRPL20, MRP-L20, 39S ribosomal protein L20, mitochondrial, Mitochondrial large ribosomal subunit protein bL20m |
MW: | 27,8 |
ab 511,00 €
Artikelnummer: ATA-APrEST84684.100
Buffer: PBS and 1M Urea, pH 7.4.
Schlagworte: | L20mt, MRPL20, MRP-L20, 39S ribosomal protein L20, mitochondrial, Mitochondrial large ribosomal subunit protein bL20m |
Anwendung: | Control antigen |
Exprimiert in: | E.coli |
Ursprungsart: | human |
247,00 €
Artikelnummer: ABD-8C14065.50
Custom conjugation services for this antibody as available (eg. labeling of Anti-MRPL20 with HRP. Available labels are AF: AF350, AF488, AF555, AF594, AF647, AF680, AF700, AF750. Proteins: HRP, Alkaline Phosphatase, Streptavidin. Tandems: APC, APC/Cy7, APC/AF750, APC/iFluor(TM) 700, APC/iFluor(TM) 750, PE, PE/Cy5,...
Schlagworte: | Anti-L20mt, Anti-MRPL20, Anti-MRP-L20, Anti-39S ribosomal protein L20, mitochondrial, Anti-Mitochondrial large ribosomal... |
Anwendung: | WB, ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse |
601,00 €