Zu "Q9BYC9" wurden 13 Artikel gefunden!

1 von 2 Seiten
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-MRPL20 (PACO01095)
Anti-MRPL20 (PACO01095)

Artikelnummer: G-PACO01095.50

MRPL20 Antibody from Assay Genie with reactivity against Human, Mouse, Rat and for use in ELISA, WB, IHC applications. MRPL20 Antibody is Polyclonal and is a IgG isotype antibody from Assay Genie.
Schlagworte: Anti-L20mt, Anti-MRPL20, Anti-MRP-L20, Anti-39S ribosomal protein L20, mitochondrial, Anti-Mitochondrial large ribosomal...
Anwendung: ELISA, WB, IHC
Reaktivität: Human, Mouse, Rat
231,00 €
Bewerten
Anti-MRPL20
Anti-MRPL20

Artikelnummer: G-PACO22089.100

MRPL20 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse, Rat and for use in ELISA, WB applications. MRPL20 Antibody is a high quality polyclonal antibody for research use only.
Schlagworte: Anti-L20mt, Anti-MRPL20, Anti-MRP-L20, Anti-39S ribosomal protein L20, mitochondrial, Anti-Mitochondrial large ribosomal...
Anwendung: ELISA, WB
Reaktivität: Human, Mouse, Rat
417,00 €
Bewerten
Anti-MRPL20
Anti-MRPL20

Artikelnummer: G-PACO40510.50

MRPL20 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC applications. MRPL20 Antibody is a high quality polyclonal antibody for research use only.
Schlagworte: Anti-L20mt, Anti-MRPL20, Anti-MRP-L20, Anti-39S ribosomal protein L20, mitochondrial, Anti-Mitochondrial large ribosomal...
Anwendung: ELISA, IHC
Reaktivität: Human
293,00 €
Bewerten
NEU
Anti-MRPL20
Anti-MRPL20

Artikelnummer: ATA-HPA047074.100

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 91% and to rat: 91%
Schlagworte: Anti-L20mt, Anti-MRPL20, Anti-MRP-L20, Anti-39S ribosomal protein L20, mitochondrial, Anti-Mitochondrial large ribosomal...
Anwendung: ICC, IHC, WB
Reaktivität: Human
ab 156,00 €
Bewerten
Anti-MRPL20
Anti-MRPL20

Artikelnummer: E-AB-18777.120

MRPL20 is one of more than 70 protein components of mitochondrial ribosomes that are encoded by the nuclear genome. MRPL20 is a subunit of the 39S mitochondrial ribosome. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA...
Schlagworte: Anti-L20mt, Anti-MRPL20, Anti-MRP-L20, Anti-39S ribosomal protein L20, mitochondrial, Anti-Mitochondrial large ribosomal...
Anwendung: WB, IHC, ELISA
Reaktivität: Human, Mouse
ab 63,00 €
Bewerten
MRPL20, Recombinant, Human, aa46-149, His-SUMO-Tag (39S Ribosomal Protein L20, Mitochondrial)
MRPL20, Recombinant, Human, aa46-149, His-SUMO-Tag (39S...

Artikelnummer: 374269.100

Source:, Recombinant protein corresponding to aa46-149 from human MRPL20, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.8kD, AA Sequence: VIRAFVKCTKARYLKKKNMRTLWINRITAASQEHGLKYPALIGNLVKCQVELNRKVLADLAIYEPKTFKSLAALASRRRHEGFAAALGDGKEPEGIFSRVVQYH, Storage and Stability: May be stored...
Schlagworte: L20mt, MRPL20, MRP-L20, 39S ribosomal protein L20, mitochondrial, Mitochondrial large ribosomal subunit protein bL20m
MW: 27,8
ab 398,00 €
Bewerten
Anti-MRPL20, HRP conjugated
Anti-MRPL20, HRP conjugated

Artikelnummer: G-PACO40511.50

MRPL20 Antibody, HRP conjugated is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA applications. MRPL20 Antibody, HRP conjugated is a high quality polyclonal antibody for research use only.
Schlagworte: Anti-L20mt, Anti-MRPL20, Anti-MRP-L20, Anti-39S ribosomal protein L20, mitochondrial, Anti-Mitochondrial large ribosomal...
Anwendung: ELISA
Reaktivität: Human
293,00 €
Bewerten
Anti-MRPL20, FITC conjugated
Anti-MRPL20, FITC conjugated

Artikelnummer: G-PACO40512.50

MRPL20 Antibody, FITC conjugated is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA applications. MRPL20 Antibody, FITC conjugated is a high quality polyclonal antibody for research use only.
Schlagworte: Anti-L20mt, Anti-MRPL20, Anti-MRP-L20, Anti-39S ribosomal protein L20, mitochondrial, Anti-Mitochondrial large ribosomal...
Anwendung: ELISA
Reaktivität: Human
293,00 €
Bewerten
Anti-MRPL20, Biotin conjugated
Anti-MRPL20, Biotin conjugated

Artikelnummer: G-PACO40513.50

MRPL20 Antibody, Biotin conjugated is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA applications. MRPL20 Antibody, Biotin conjugated is a high quality polyclonal antibody for research use only.
Schlagworte: Anti-L20mt, Anti-MRPL20, Anti-MRP-L20, Anti-39S ribosomal protein L20, mitochondrial, Anti-Mitochondrial large ribosomal...
Anwendung: ELISA
Reaktivität: Human
293,00 €
Bewerten
NEU
MRPL20 PrEST Antigen
MRPL20 PrEST Antigen

Artikelnummer: ATA-APrEST84684.100

Buffer: PBS and 1M Urea, pH 7.4.
Schlagworte: L20mt, MRPL20, MRP-L20, 39S ribosomal protein L20, mitochondrial, Mitochondrial large ribosomal subunit protein bL20m
Anwendung: Control antigen
Reaktivität: Human
186,00 €
Bewerten
NEU
MRPL20 QPrEST Mass Spectroscopy Protein Standard
MRPL20 QPrEST Mass Spectroscopy Protein Standard

Artikelnummer: ATA-QPrEST35640.1

Buffer: 1M Urea PBS, pH 7.4.
Anwendung: MS
Reaktivität: Human
789,00 €
Bewerten
Anti-MRPL20
Anti-MRPL20

Artikelnummer: ABD-8C14065.50

Custom conjugation services for this antibody as available (eg. labeling of Anti-MRPL20 with HRP. Available labels are AF: AF350, AF488, AF555, AF594, AF647, AF680, AF700, AF750. Proteins: HRP, Alkaline Phosphatase, Streptavidin. Tandems: APC, APC/Cy7, APC/AF750, APC/iFluor(TM) 700, APC/iFluor(TM) 750, PE, PE/Cy5,...
Schlagworte: Anti-L20mt, Anti-MRPL20, Anti-MRP-L20, Anti-39S ribosomal protein L20, mitochondrial, Anti-Mitochondrial large ribosomal...
Anwendung: WB, ELISA
Reaktivität: Human, Mouse
230,00 €
Bewerten
1 von 2 Seiten