Zu "P18088" wurden 4 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Rat GAD1 (Glutamate Decarboxylase 1, Brain) ELISA Kit
Artikelnummer: ELK-ELK7508.48
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Rat GAD1. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Rat GAD1. Next,...
| Schlagworte: | Gad1, Gad67, GAD-67, Glutamate decarboxylase 1, 67 kDa glutamic acid decarboxylase, Glutamate decarboxylase 67 kDa isoform |
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
ab 365,00 €
Gad1, Rat glutamate decarboxylase 1, Real Time PCR Primer...
Artikelnummer: VRPS-2259
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | Gad1, Gad67, GAD-67, EC=4.1.1.15, Glutamate decarboxylase 1, 67 kDa glutamic acid decarboxylase, Glutamate decarboxylase... |
| Anwendung: | RNA quantification |
52,00 €
Glutamate Decarboxylase 1, Brain (GAD1) Recombinant, Rat
Artikelnummer: 154786.10
Source:, Recombinant Rat from E. coli, Purity: >95%, Endotoxin: 1.0EU per 1ug (determined by the LAL method), Accession No: P18088, Fragment: Met1~Leu97 (Accession No: P18088), Sequence: MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-MASSTPSPAT SSNAGADPNT TNLRPTTYDT WCGVAHGCTR KLGLKICGFL QRTNSLEEKS RLVSAFRERQ...
ab 387,00 €
Rat GAD1 / Glutamate decarboxylase 1 ELISA Kit
Artikelnummer: G-RTFI00343.96
| Anwendung: | ELISA |
| Spezies-Reaktivität: | rat |
694,00 €
