Zu "P05600" wurden 3 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Ovomucoid, partial, Coturnix delegorguei, recombinant
Artikelnummer: CSB-EP356564CRB.1
Organism: Coturnix delegorguei (Harlequin quail). Source: E.coli. Expression Region: 1-52aa. Protein Length: Partial. Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged. Target Protein Sequence: SVDCSEYPKP ACPKDYRPVC GSDNKTYGNK CNFCNAVVES NGTLTLNRFG KC. Purity: Greater than 90% as determined by...
| Schlagworte: | Ovomucoid, Recombinant Coturnix delegorguei Ovomucoid, partial |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | Coturnix delegorguei (Harlequin quail) |
| MW: | 25.7 kD |
ab 354,00 €
NEU
Ovomucoid Protein, Coturnix delegorguei, Recombinant (His...
Artikelnummer: TGM-TMPH-00434-100ug
Description: Ovomucoid Protein, Coturnix delegorguei, Recombinant (His & Myc & SUMO) is expressed in E. coli.
| Schlagworte: | Ovomucoid |
| MW: | 25.7 kD |
ab 352,00 €
Ovomucoid, Recombinant, Coturnix Delegorguei, aa1-52,...
Artikelnummer: 406011.100
Source:, Recombinant protein corresponding to aa1-52 from Coturnix delegorguei Ovomucoid, fused to His-SUMO-Tag at N-terminal and fused to Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~25.7kD, AA Sequence: SVDCSEYPKPACPKDYRPVCGSDNKTYGNKCNFCNAVVESNGTLTLNRFGKC, Storage and Stability: May be stored...
| Schlagworte: | Ovomucoid |
| MW: | 25,7 |
ab 636,00 €
