- Suchergebnis für O88745
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "O88745" wurden 11 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: CSB-YP526023MO.1
Organism: Mus musculus (Mouse). Source: Yeast. Expression Region: 21-98aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: MPSSRLSCYR KLLKDRNCHN LPEGRADLKL IDANVQHHFW DGKGCEMICY CNFSELLCCP KDVFFGPKIS FVIPCNNH. Purity: Greater than 90% as determined by...
| Schlagworte: | Scrg1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein, Recombinant Mouse Scrapie-responsive... |
| Anwendung: | Activity not tested |
| Exprimiert in: | Yeast |
| Ursprungsart: | mouse |
| MW: | 11 kD |
ab 347,00 €
Artikelnummer: CSB-EP526023MO.1
Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 21-98aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: MPSSRLSCYR KLLKDRNCHN LPEGRADLKL IDANVQHHFW DGKGCEMICY CNFSELLCCP KDVFFGPKIS FVIPCNNH. Purity: Greater than 90% as determined by...
| Schlagworte: | Scrg1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein, Recombinant Mouse Scrapie-responsive... |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | mouse |
| MW: | 25 kD |
ab 292,00 €
Artikelnummer: CSB-EP526023MOa0.1
Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 21-98aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: MPSSRLSCYR KLLKDRNCHN LPEGRADLKL IDANVQHHFW DGKGCEMICY CNFSELLCCP KDVFFGPKIS FVIPCNNH. Purity: Greater than 85% as determined by...
| Schlagworte: | Scrg1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein, Recombinant Mouse Scrapie-responsive... |
| Anwendung: | Activity not tested |
| Exprimiert in: | E.coli |
| Ursprungsart: | mouse |
| MW: | 15.0 kD |
ab 292,00 €
Artikelnummer: TGM-TMPH-02887-10ug
Description: SCRG1 Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 15.0 kDa and the accession number is O88745?.
| Schlagworte: | Scrapie-responsive protein 1 , Scrg1 , Scrapie-responsive gene 1 protein |
| MW: | 15 kD |
ab 99,00 €
Artikelnummer: VMPS-5717
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | Scrg1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein |
| Anwendung: | RNA quantification |
45,00 €
Artikelnummer: G-PACO35130.50
Scrg1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Mouse and for use in ELISA applications. Scrg1 Antibody is a high quality polyclonal antibody for research use only.
| Schlagworte: | Anti-Scrg1, Anti-ScRG-1, Anti-Scrapie-responsive protein 1, Anti-Scrapie-responsive gene 1 protein |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | mouse |
313,00 €
Artikelnummer: 375227.100
Source:, Recombinant protein corresponding to aa21-98 from mouse Scrg1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~11.0kD, AA Sequence: MPSSRLSCYRKLLKDRNCHNLPEGRADLKLIDANVQHHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNH, Storage and Stability: May be stored at 4°C for short-term only. Aliquot...
| Schlagworte: | Scrg1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein |
| MW: | 11 |
ab 636,00 €
Artikelnummer: CSB-PA526023HC01MO.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: Scrg1. Antigen Species: Mouse
| Schlagworte: | Anti-Scrg1, Anti-ScRG-1, Anti-Scrapie-responsive protein 1, Anti-Scrapie-responsive gene 1 protein, Scrg1 antibody,... |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | mouse |
ab 167,00 €
Artikelnummer: CSB-PA526023HD01MO.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: Scrg1. Antigen Species: Mouse
| Schlagworte: | Anti-Scrg1, Anti-ScRG-1, Anti-Scrapie-responsive protein 1, Anti-Scrapie-responsive gene 1 protein, Scrg1 antibody,... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | mouse |
ab 167,00 €
Artikelnummer: CSB-PA526023HA01MO.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: Scrg1. Antigen Species: Mouse
| Schlagworte: | Anti-Scrg1, Anti-ScRG-1, Anti-Scrapie-responsive protein 1, Anti-Scrapie-responsive gene 1 protein, Scrg1 antibody,... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | mouse |
ab 167,00 €
Artikelnummer: CSB-PA526023HB01MO.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: Scrg1. Antigen Species: Mouse
| Schlagworte: | Anti-Scrg1, Anti-ScRG-1, Anti-Scrapie-responsive protein 1, Anti-Scrapie-responsive gene 1 protein, Scrg1 antibody,... |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | mouse |
ab 167,00 €