Zu "O88745" wurden 3 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Scrg1, Mouse scrapie responsive gene 1, Real Time PCR...
Artikelnummer: VMPS-5717
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Schlagworte: | Scrg1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein |
| Anwendung: | RNA quantification |
43,00 €
Anti-Scrg1
Artikelnummer: G-PACO35130.50
Scrg1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Mouse and for use in ELISA applications. Scrg1 Antibody is a high quality polyclonal antibody for research use only.
| Schlagworte: | Anti-Scrg1, Anti-ScRG-1, Anti-Scrapie-responsive protein 1, Anti-Scrapie-responsive gene 1 protein |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | mouse |
363,00 €
Scrg1, Recombinant, Mouse, aa21-98, His-Tag...
Artikelnummer: 375227.100
Source:, Recombinant protein corresponding to aa21-98 from mouse Scrg1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~11.0kD, AA Sequence: MPSSRLSCYRKLLKDRNCHNLPEGRADLKLIDANVQHHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNH, Storage and Stability: May be stored at 4°C for short-term only. Aliquot...
| Schlagworte: | SCRG1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein |
| MW: | 11 |
ab 497,00 €
