- Suchergebnis für K04256
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "K04256" wurden 8 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: G-CAB15803.100
WB 1:500 - 1:2000. Protein function: May play a role in encephalic photoreception. [The UniProt Consortium]
Schlagworte: | Anti-OPN3, Anti-ECPN, Anti-Opsin-3, Anti-Panopsin, Anti-Encephalopsin, OPN3 Polyclonal Antibody (CAB15803) |
Anwendung: | WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
ab 352,00 €
Artikelnummer: G-PACO53826.50
Vertebrate ancient opsin Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Salmo salar and for use in ELISA, WB applications. Vertebrate ancient opsin Antibody is a high quality polyclonal antibody for research use only.
Schlagworte: | Anti-Vertebrate ancient opsin |
Anwendung: | ELISA, WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | Salmo salar |
363,00 €
Artikelnummer: E-AB-91289.120
Opsins are members of the guanine nucleotide-binding protein (G protein)-coupled receptor superfamily. In addition to the visual opsins, mammals possess several photoreceptive non-visual opsins that are expressed in extraocular tissues. This gene, opsin 3, is strongly expressed in brain and testis and weakly...
Schlagworte: | ECPN, OPN3, Opsin-3, Panopsin, Encephalopsin, OPN3 Polyclonal Antibody |
Anwendung: | WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
ab 198,00 €
Artikelnummer: ELK-ES5368.100
Opsins are members of the guanine nucleotide-binding protein (G protein)-coupled receptor superfamily. In addition to the visual opsins, mammals possess several photoreceptive non-visual opsins that are expressed in extraocular tissues. This gene, opsin 3, is strongly expressed in brain and testis and weakly...
Schlagworte: | Anti-ECPN, Anti-OPN3, Anti-Opsin-3, Anti-Panopsin, Anti-Encephalopsin, Encephalopsin rabbit pAb |
Anwendung: | WB, IHC, IF, ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse |
ab 169,00 €
Artikelnummer: 370824.100
Source:, Recombinant protein corresponding to aa1-75 from salmon Vertebrate ancient opsin, fused to His-B2M-Tag at N-terminal, expressed in E. coli. AA Sequence: MDTLRIAVNGVSYNEASEIYKPHADPFTGPITNLAPWNFAVLATLMFVITSLSLFENFTVMLATYKFKQLRQPLN, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to...
Schlagworte: | Vertebrate ancient opsin |
ab 636,00 €
Artikelnummer: G-CAB15803.20
Protein function: G-protein coupled receptor which selectively activates G proteins via ultraviolet A (UVA) light-mediated activation in the skin (PubMed:28842328, PubMed:31380578, PubMed:31097585). Binds both 11-cis retinal and all-trans retinal (PubMed:31097585). Regulates melanogenesis in melanocytes via...
Schlagworte: | Anti-OPN3, Anti-ECPN, Anti-Opsin-3, Anti-Panopsin, Anti-Encephalopsin |
Anwendung: | WB |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
149,00 €
Artikelnummer: ABD-8G093.50
Custom conjugation services for this antibody as available (eg. labeling of Anti-Encephalopsin with HRP. Available labels are AF: AF350, AF488, AF555, AF594, AF647, AF680, AF700, AF750. Proteins: HRP, Alkaline Phosphatase, Streptavidin. Tandems: APC, APC/Cy7, APC/AF750, APC/iFluor(TM) 700, APC/iFluor(TM) 750, PE,...
Schlagworte: | Anti-OPN3, Anti-ECPN, Anti-Opsin-3, Anti-Panopsin, Anti-Encephalopsin, Encephalopsin Antibody |
Anwendung: | WB, IF, ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse |
601,00 €
Artikelnummer: ABD-8G487.50
Custom conjugation services for this antibody as available (eg. labeling of Anti-OPN3 with HRP. Available labels are AF: AF350, AF488, AF555, AF594, AF647, AF680, AF700, AF750. Proteins: HRP, Alkaline Phosphatase, Streptavidin. Tandems: APC, APC/Cy7, APC/AF750, APC/iFluor(TM) 700, APC/iFluor(TM) 750, PE, PE/Cy5,...
Schlagworte: | Anti-OPN3, Anti-ECPN, Anti-Opsin-3, Anti-Panopsin, Anti-Encephalopsin, OPN3 Antibody |
Anwendung: | WB, ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse |
601,00 €