Zu "K04256" wurden 8 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-OPN3
Artikelnummer: G-CAB15803.100
WB 1:500 - 1:2000. Protein function: May play a role in encephalic photoreception. [The UniProt Consortium]
| Schlagworte: | Anti-OPN3, Anti-ECPN, Anti-Opsin-3, Anti-Panopsin, Anti-Encephalopsin, OPN3 Polyclonal Antibody (CAB15803) |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 352,00 €
Anti-Vertebrate ancient opsin
Artikelnummer: G-PACO53826.50
Vertebrate ancient opsin Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Salmo salar and for use in ELISA, WB applications. Vertebrate ancient opsin Antibody is a high quality polyclonal antibody for research use only.
| Schlagworte: | Anti-Vertebrate ancient opsin |
| Anwendung: | ELISA, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | Salmo salar |
363,00 €
Anti-OPN3
Artikelnummer: E-AB-91289.120
Opsins are members of the guanine nucleotide-binding protein (G protein)-coupled receptor superfamily. In addition to the visual opsins, mammals possess several photoreceptive non-visual opsins that are expressed in extraocular tissues. This gene, opsin 3, is strongly expressed in brain and testis and weakly...
| Schlagworte: | ECPN, OPN3, Opsin-3, Panopsin, Encephalopsin, OPN3 Polyclonal Antibody |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
ab 198,00 €
Anti-Encephalopsin
Artikelnummer: ELK-ES5368.100
Opsins are members of the guanine nucleotide-binding protein (G protein)-coupled receptor superfamily. In addition to the visual opsins, mammals possess several photoreceptive non-visual opsins that are expressed in extraocular tissues. This gene, opsin 3, is strongly expressed in brain and testis and weakly...
| Schlagworte: | Anti-ECPN, Anti-OPN3, Anti-Opsin-3, Anti-Panopsin, Anti-Encephalopsin, Encephalopsin rabbit pAb |
| Anwendung: | WB, IHC, IF, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 169,00 €
Vertebrate Ancient Opsin, Recombinant, Atlantic Salmon,...
Artikelnummer: 370824.100
Source:, Recombinant protein corresponding to aa1-75 from salmon Vertebrate ancient opsin, fused to His-B2M-Tag at N-terminal, expressed in E. coli. AA Sequence: MDTLRIAVNGVSYNEASEIYKPHADPFTGPITNLAPWNFAVLATLMFVITSLSLFENFTVMLATYKFKQLRQPLN, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to...
| Schlagworte: | Vertebrate ancient opsin |
ab 636,00 €
Anti-OPN3
Artikelnummer: G-CAB15803.20
Protein function: G-protein coupled receptor which selectively activates G proteins via ultraviolet A (UVA) light-mediated activation in the skin (PubMed:28842328, PubMed:31380578, PubMed:31097585). Binds both 11-cis retinal and all-trans retinal (PubMed:31097585). Regulates melanogenesis in melanocytes via...
| Schlagworte: | Anti-OPN3, Anti-ECPN, Anti-Opsin-3, Anti-Panopsin, Anti-Encephalopsin |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
149,00 €
Anti-Encephalopsin
Artikelnummer: ABD-8G093.50
Custom conjugation services for this antibody as available (eg. labeling of Anti-Encephalopsin with HRP. Available labels are AF: AF350, AF488, AF555, AF594, AF647, AF680, AF700, AF750. Proteins: HRP, Alkaline Phosphatase, Streptavidin. Tandems: APC, APC/Cy7, APC/AF750, APC/iFluor(TM) 700, APC/iFluor(TM) 750, PE,...
| Schlagworte: | Anti-OPN3, Anti-ECPN, Anti-Opsin-3, Anti-Panopsin, Anti-Encephalopsin, Encephalopsin Antibody |
| Anwendung: | WB, IF, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
601,00 €
Anti-OPN3
Artikelnummer: ABD-8G487.50
Custom conjugation services for this antibody as available (eg. labeling of Anti-OPN3 with HRP. Available labels are AF: AF350, AF488, AF555, AF594, AF647, AF680, AF700, AF750. Proteins: HRP, Alkaline Phosphatase, Streptavidin. Tandems: APC, APC/Cy7, APC/AF750, APC/iFluor(TM) 700, APC/iFluor(TM) 750, PE, PE/Cy5,...
| Schlagworte: | Anti-OPN3, Anti-ECPN, Anti-Opsin-3, Anti-Panopsin, Anti-Encephalopsin, OPN3 Antibody |
| Anwendung: | WB, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
601,00 €