- Suchergebnis für GeneID 26234
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "GeneID 26234" wurden 14 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: ATA-HPA002484.100
Polyclonal Antibody against Human FBXL5, Gene description: F-box and leucine rich repeat protein 5, Alternative Gene Names: FBL4, FBL5, FLR1, Validated applications: IHC, Uniprot ID: Q9UKA1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Component of some...
| Schlagworte: | Anti-FBL4, Anti-FBXL5, Anti-p45SKP2-like protein, Anti-F-box protein FBL4/FBL5, Anti-F-box/LRR-repeat protein 5,... |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
491,00 €
NEU
Artikelnummer: ATA-HPA002484.25
Polyclonal Antibody against Human FBXL5, Gene description: F-box and leucine rich repeat protein 5, Alternative Gene Names: FBL4, FBL5, FLR1, Validated applications: IHC, Uniprot ID: Q9UKA1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Component of some...
| Schlagworte: | Anti-FBL4, Anti-FBXL5, Anti-p45SKP2-like protein, Anti-F-box protein FBL4/FBL5, Anti-F-box/LRR-repeat protein 5,... |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
361,00 €
Artikelnummer: ABS-PP-8762-L.100
Protein function: Component of some SCF (SKP1-cullin-F-box) protein ligase complex that plays a central role in iron homeostasis by promoting the ubiquitination and subsequent degradation of IREB2/IRP2. Upon high iron and oxygen level, it specifically recognizes and binds IREB2/IRP2, promoting its ubiquitination and...
| Schlagworte: | F-box/LRR-repeat protein 5, F-box and leucine-rich repeat protein 5, F-box protein FBL4/FBL5, p45SKP2-like protein,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 15 kD |
ab 115,00 €
Artikelnummer: 035545-Biotin.200
Applications:, Suitable for use in Western Blot, Immunohistochemistry, Flow Cytometry, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Immunohistochemistry: 1:50-100, Flow Cytometry: 1:10-50, Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage,...
| Schlagworte: | Anti-FBL4, Anti-FBXL5, Anti-p45SKP2-like protein, Anti-F-box protein FBL4/FBL5, Anti-F-box/LRR-repeat protein 5,... |
| Anwendung: | ELISA, FC, IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
1.104,00 €
Artikelnummer: 035545.200
Applications:, Suitable for use in Western Blot, Immunohistochemistry, Flow Cytometry, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Immunohistochemistry: 1:50-100, Flow Cytometry: 1:10-50, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and...
| Schlagworte: | Anti-FBL4, Anti-FBXL5, Anti-p45SKP2-like protein, Anti-F-box protein FBL4/FBL5, Anti-F-box/LRR-repeat protein 5,... |
| Anwendung: | ELISA, FC, IHC, WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
865,00 €
Artikelnummer: G-CAB5602.20
Protein function: Component of some SCF (SKP1-cullin-F-box) protein ligase complex that plays a central role in iron homeostasis by promoting the ubiquitination and subsequent degradation of IREB2/IRP2. Upon high iron and oxygen level, it specifically recognizes and binds IREB2/IRP2, promoting its ubiquitination and...
| Schlagworte: | Anti-FBL4, Anti-FBXL5, Anti-p45SKP2-like protein, Anti-F-box protein FBL4/FBL5, Anti-F-box/LRR-repeat protein 5,... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
103,00 €
Artikelnummer: ELK-ES16499.100
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The...
| Schlagworte: | Anti-FBL4, Anti-FBXL5, Anti-p45SKP2-like protein, Anti-F-box protein FBL4/FBL5, Anti-F-box/LRR-repeat protein 5,... |
| Anwendung: | WB |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 173,00 €
Artikelnummer: CSB-CL892451HU.10
Length: 2076 Sequence: atggcgccct ttcctgaaga agtggacgtc ttcaccgccc cacactggcg gatgaagcag ctggtggggc tctactgcga caagctttct aaaaccaatt tttccaacaa caacgatttc cgtgctcttc tgcagtcttt gtatgctact ttcacggagt tcaaaatgca tgagcagatt gaaaatgaat acattattgg tttgcttcaa caacgcagcc agaccattta taatgtacat tctgacaata aactctccga...
| Schlagworte: | FBL4, FBXL5, p45SKP2-like protein, F-box protein FBL4/FBL5, F-box/LRR-repeat protein 5, F-box and leucine-rich repeat... |
| Anwendung: | Molecular biology, clone |
| Spezies-Reaktivität: | human |
482,00 €
Artikelnummer: CSB-PA892451ESR1HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: FBXL5. Antigen Species: Human
| Schlagworte: | Anti-FBL4, Anti-FBXL5, Anti-p45SKP2-like protein, Anti-F-box protein FBL4/FBL5, Anti-F-box/LRR-repeat protein 5,... |
| Anwendung: | ELISA, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 167,00 €
Artikelnummer: CSB-PA892451ESR2HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: Antigen Affinity Purified. Target Name: FBXL5. Antigen Species: Human
| Schlagworte: | Anti-FBL4, Anti-FBXL5, Anti-p45SKP2-like protein, Anti-F-box protein FBL4/FBL5, Anti-F-box/LRR-repeat protein 5,... |
| Anwendung: | ELISA, WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 167,00 €
Artikelnummer: ABS-PP-8762.100
Protein function: Component of some SCF (SKP1-cullin-F-box) protein ligase complex that plays a central role in iron homeostasis by promoting the ubiquitination and subsequent degradation of IREB2/IRP2. Upon high iron and oxygen level, it specifically recognizes and binds IREB2/IRP2, promoting its ubiquitination and...
| Schlagworte: | F-box/LRR-repeat protein 5, F-box and leucine-rich repeat protein 5, F-box protein FBL4/FBL5, p45SKP2-like protein,... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
| MW: | 15 kD |
ab 90,00 €
Artikelnummer: ATA-APrEST95812.100
PrEST Antigen FBXL5, Gene description: F-box and leucine rich repeat protein 5, Alternative Gene Names: FBL4, FBL5, FLR1, Antigen sequence: VSSKMVRQILELCPNLEHLDLTQTDISDSAFDSWSWLGCCQSLRHLDLSGCEKITDVALEKISRALGILTSHQSGFLKTSTSKITSTAWKNKDITMQSTKQYACLHDLTNKGIGEEIDNEHPWTKPVSSENFTSPYVWMLDAEDLADI, Storage: Upon delivery...
| Schlagworte: | FBL4, FBXL5, p45SKP2-like protein, F-box protein FBL4/FBL5, F-box/LRR-repeat protein 5, F-box and leucine-rich repeat... |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
264,00 €