Txndc12, Recombinant, Mouse, aa25-170, His-Tag (Thioredoxin Domain-containing Protein 12)

Possesses significant protein thiol-disulfide oxidase activity. Source: Recombinant protein corresponding to aa25-170 from mouse Txndc12, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~18.5kD, AA Sequence: RTGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPRDEDFSPDGGYIPRILFLDPSGKVRPEIINESGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFREKHFQDEL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.