Tumor Necrosis Factor Receptor Superfamily Member 9, Recombinant, Human, aa24-186, Fc-Tag (TNFRSF9)

Tumor Necrosis Factor Receptor Superfamily Member 9, Recombinant, Human, aa24-186, Fc-Tag (TNFRSF9)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
516830.10 10 µg - -

3 - 19 Werktage*

379,00 €
516830.50 50 µg - -

3 - 19 Werktage*

682,00 €
 
Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation.||Source:|Recombinant... mehr
Produktinformationen "Tumor Necrosis Factor Receptor Superfamily Member 9, Recombinant, Human, aa24-186, Fc-Tag (TNFRSF9)"
Receptor for TNFSF9/4-1BBL. Possibly active during T cell activation. Source: Recombinant protein corresponding to aa24-186 of human Tumor Necrosis Factor Receptor Superfamily Member 9, fused to Fc-Tag at C-terminal, expressed in mammalian cell. Molecular Weight: ~44.2kD, Biological Activity: The ED50 as determined by its ability to bind human TNFSF9 in functional ELISA is less than 20ug/ml. Endotoxin: <1EU/ug (LAL). AA Sequence: LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ, Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile buffer or ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: CD137, CDw137, TNFRSF9, T-cell antigen ILA, 4-1BB ligand receptor, T-cell antigen 4-1BB homolog, Tumor necrosis factor receptor superfamily member 9
Hersteller: United States Biological
Hersteller-Nr: 516830

Eigenschaften

Konjugat: No
Wirt: Mammalian cells
Spezies-Reaktivität: human
MW: 44.2 kD
Reinheit: >=95% (SDS-PAGE)
Format: Lyophilized

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Tumor Necrosis Factor Receptor Superfamily Member 9, Recombinant, Human, aa24-186, Fc-Tag (TNFRSF9)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen