TRIM24, Recombinant, Human, aa896-1014, His-Tag (TIF1, Tripartite Motif Containing 24)

TRIM24, Recombinant, Human, aa896-1014, His-Tag (TIF1, Tripartite Motif Containing 24)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
298485.100 100 µg - -

3 - 19 Werktage*

916,00 €
 
The protein encoded by this gene mediates transcriptional control by interaction with the... mehr
Produktinformationen "TRIM24, Recombinant, Human, aa896-1014, His-Tag (TIF1, Tripartite Motif Containing 24)"
The protein encoded by this gene mediates transcriptional control by interaction with the activation function 2 (AF2) region of several nuclear receptors, including the estrogen, retinoic acid, and vitamin D3 receptors. The protein localizes to nuclear bodies and is thought to associate with chromatin and heterochromatin-associated factors. The protein is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains - a RING, a B-box type 1 and a B-box type 2 - and a coiled-coil region. Two alternatively spliced transcript, variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]. Source: Recombinant protein corresponding to aa896-1014 from human bromodomain tripartite motif containing 24, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~15kD, AA Sequence: MHHHHHHGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLS, TIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLY, PEKRFPKPE, Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Schlagworte: RNF82, TRIM24, TIF1-alpha, EC=2.3.2.27, RING finger protein 82, E3 ubiquitin-protein ligase TRIM24, Tripartite motif-containing protein 24, Transcription intermediary factor 1-alpha, RING-type E3 ubiquitin transferase TIF1-alpha
Hersteller: United States Biological
Hersteller-Nr: 298485

Eigenschaften

Konjugat: No
MW: 15
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: -80°C
Versand: -80°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "TRIM24, Recombinant, Human, aa896-1014, His-Tag (TIF1, Tripartite Motif Containing 24)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen