Tmprss4, Recombinant, Mouse, aa52-435, HIs-SUMO-Tag (Transmembrane Protease Serine 4)

Tmprss4, Recombinant, Mouse, aa52-435, HIs-SUMO-Tag (Transmembrane Protease Serine 4)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375608.20 20 µg - -

3 - 19 Werktage*

575,00 €
375608.100 100 µg - -

3 - 19 Werktage*

855,00 €
 
Probable protease. Seems to be capable of activating ENaC.||Source:|Recombinant protein... mehr
Produktinformationen "Tmprss4, Recombinant, Mouse, aa52-435, HIs-SUMO-Tag (Transmembrane Protease Serine 4)"
Probable protease. Seems to be capable of activating ENaC. Source: Recombinant protein corresponding to aa52-435 from mouse Tmprss4, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~57.8kD, AA Sequence: KVILDKYYFICGSPLTFIQRGQLCDGHLDCASGEDEEHCVKDFPEKPGVAVRLSKDRSTLQVLDAATGTWASVCFDNFTEALAKTACRQMGYDSQPAFRAVEIRPDQNLPVAQVTGNSQELQVQNGSRSCLSGSLVSLRCLDCGKSLKTPRVVGGVEAPVDSWPWQVSIQYNKQHVCGGSILDPHWILTAAHCFRKYLDVSSWKVRAGSNILGNSPSLPVAKIFIAEPNPLYPKEKDIALVKLQMPLTFSGSVRPICLPFSDEVLVPATPVWVIGWGFTEENGGKMSDMLLQASVQVIDSTRCNAEDAYEGEVTAEMLCAGTPQGGKDTCQGDSGGPLMYHSDKWQVVGIVSWGHGCGGPSTPGVYTKVTAYLNWIYNVRKSEM, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Cap2, mCAP2, Tmprss4, EC=3.4.21.-, Channel-activating protease 2, Transmembrane protease serine 4
Hersteller: United States Biological
Hersteller-Nr: 375608

Eigenschaften

Konjugat: No
MW: 57,8
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Tmprss4, Recombinant, Mouse, aa52-435, HIs-SUMO-Tag (Transmembrane Protease Serine 4)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen