Serum Amyloid A Protein, Recombinant, Equine, aa1-110, His-Tag (SAA1)

Major acute phase reactant. Apolipoprotein of the HDL complex. Source: Recombinant full length protein corresponding to aa1-110 of equine Serum Amyloid A Protein, fused to 10xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~15.8kD, AA Sequence: LLSFLGEAARGTWDMIRAYNDMREANYIGADKYFHARGNYDAAKRGPGGAWAAKVISDARENFQRFTDRFSFGGSGRGAEDSRADQAANEWGRSGKDPNHFRPHGLPDKY, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.