Serpina1, Recombinant, Rat, aa25-411, His-Tag (Alpha-1-antiproteinase)

Serpina1, Recombinant, Rat, aa25-411, His-Tag (Alpha-1-antiproteinase)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375263.20 20 µg - -

3 - 19 Werktage*

537,00 €
375263.100 100 µg - -

3 - 19 Werktage*

834,00 €
 
Inhibitor of serine proteases. Its primary target is elastase, but it also has a moderate... mehr
Produktinformationen "Serpina1, Recombinant, Rat, aa25-411, His-Tag (Alpha-1-antiproteinase)"
Inhibitor of serine proteases. Its primary target is elastase, but it also has a moderate affinity for plasmin and thrombin. Irreversibly inhibits trypsin, chymotrypsin and plasminogen activator. The aberrant form inhibits insulin-induced NO synthesis in platelets, decreases coagulation time and has proteolytic activity against insulin and plasmin. Short peptide from AAT: reversible chymotrypsin inhibitor. It also inhibits elastase, but not trypsin. Its major physiological function is the protection of the lower respiratory tract against proteolytic destruction by human leukocyte elastase (HLE). Source: Recombinant protein corresponding to aa25-411 from rat Serpina1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~45.7kD, AA Sequence: EDAQETDTSQQDQSPTYRKISSNLADFAFSLYRELVHQSNTSNIFFSPMSITTAFAMLSLGSKGDTRKQILEGLEFNLTQIPEADIHKAFHHLLQTLNRPDSELQLNTGNGLFVNKNLKLVEKFLEEVKNNYHSEAFSVNFADSEEAKKVINDYVEKGTQGKIVDLMKQLDEDTVFALVNYIFFKGKWKRPFNPEHTRDADFHVDKSTTVKVPMMNRLGMFDMHYCSTLSSWVLMMDYLGNATAIFLLPDDGKMQHLEQTLTKDLISRFLLNRQTRSAILYFPKLSISGTYNLKTLLSSLGITRVFNNDADLSGITEDAPLKLSQAVHKAVLTLDERGTEAAGATVVEAVPMSLPPQVKFDHPFIFMIVESETQSPLFVGKVIDPTR, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Serpina1, Serpin A1, Alpha-1-antitrypsin, Alpha-1-antiproteinase, Alpha-1-proteinase inhibitor
Hersteller: United States Biological
Hersteller-Nr: 375263

Eigenschaften

Konjugat: No
Spezies-Reaktivität: rat
MW: 45.7 kD
Reinheit: ~90% (SDS-PAGE)

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Serpina1, Recombinant, Rat, aa25-411, His-Tag (Alpha-1-antiproteinase)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen