SEPP1, Recombinant, Bovine, aa20-402, GST-Tag (Selenoprotein P)

SEPP1, Recombinant, Bovine, aa20-402, GST-Tag (Selenoprotein P)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375249.20 20 µg - -

3 - 19 Werktage*

511,00 €
375249.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Constitutes a major selenium pool in the brain and may play an important role in developing... mehr
Produktinformationen "SEPP1, Recombinant, Bovine, aa20-402, GST-Tag (Selenoprotein P)"
Constitutes a major selenium pool in the brain and may play an important role in developing and/or modulating the morphology of neurons and/or glial cells. Source: Recombinant protein corresponding to aa20-402 from bovine SEPP1, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~70.1kD, AA Sequence: ESQGQSSYCKQPPPWSIKDQDPMLNSYGSVTVVALLQASUYLCILQASRLEDLRVKLEKEGYSNISYVVVNHQGISSRLKYVHLKNKVSEHIPVYQQEENQPDVWTLLNGNKDDFLIYDRCGRLVYHLGLPYSFLTFTYVEDSIKTVYCEDKCGNCSLKALEDEDVCKNVFLATKEKTAEASQRHHHPHPHSHPHPHPHPHPHPHPHPHHGHQLHENAHLSESPKPDTPDTPENPPPSGLHHHHHRHKGPQRQGHSDNCDTPVGSESLQPSLPQKKLURKRCINQLLUQFPKDSESALSSCCCHCRHLVFEKTGSAITUQCTEKLPSLCSUQGLLAEENVIESUQURLPPAAUQAAGQQLNPTEASTKUSUKNKAKMUKUPSN, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: SeP, Selenoprotein P, Selenoprotein P-like protein
Hersteller: United States Biological
Hersteller-Nr: 375249

Eigenschaften

Konjugat: No
MW: 70,1
Format: Highly Purified

Datenbank Information

UniProt ID : P49907 | Passende Produkte
Gene ID : GeneID 282066 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "SEPP1, Recombinant, Bovine, aa20-402, GST-Tag (Selenoprotein P)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen