SELE, Recombinant, Porcine, aa23-429, GST-Tag (E-selectin)

SELE, Recombinant, Porcine, aa23-429, GST-Tag (E-selectin)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375240.20 20 µg - -

3 - 19 Werktage*

511,00 €
375240.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Cell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood... mehr
Produktinformationen "SELE, Recombinant, Porcine, aa23-429, GST-Tag (E-selectin)"
Cell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood neutrophils in cytokine-activated endothelium through interaction with PSGL1/SELPLG. May have a role in capillary morphogenesis. Source: Recombinant protein corresponding to aa23-429 from human SELE, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~71.3kD, AA Sequence: WSYSASTETMTFDDASAYCQQRYTHLVAIQNHAEIEYLNSTFNYSASYYWIGIRKINGTWTWIGTKKALTPEATNWAPGEPNNKQSNEDCVEIYIKRDKDSGKWNDERCSKKKLALCYTAACTPTSCSGHGECIETINSSTCQCYPGFRGLQCEQVVECDALENPVNGVVTCPQSLPWNTTCAFECKEGFELIGPEHLQCTSSGSWDGKKPTCKAVTCDTVGHPQNGDVSCNHSSIGEFAYKSTCHFTCAEGFGLQGPAQIECTAQGQWTQQAPVCKAVKCPAVSQPKNGLVKFTHSPTGEFTYKSSCAFSCEEGFELRGSAQLACTSQGQWTQEVPSCQVVQCSSLEVPREINMSCSGEPVFGAVCTFACPEGWMLNGSVALTCGATGHWSGMLPTCEAPAESKIP, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: SELE, CD62E, ELAM-1, LECAM2, E-selectin, CD62 antigen-like family member E, Endothelial leukocyte adhesion molecule 1, Leukocyte-endothelial cell adhesion molecule 2
Hersteller: United States Biological
Hersteller-Nr: 375240

Eigenschaften

Konjugat: No
MW: 71,3
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "SELE, Recombinant, Porcine, aa23-429, GST-Tag (E-selectin)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen