SART3, Recombinant, Human, aa600-900, His-Tag (Squamous Cell Carcinoma Antigen Recognized by T-Cells

SART3, Recombinant, Human, aa600-900, His-Tag (Squamous Cell Carcinoma Antigen Recognized by T-Cells
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375210.20 20 µg - -

3 - 19 Werktage*

416,00 €
375210.100 100 µg - -

3 - 19 Werktage*

637,00 €
 
U6 snRNP-binding protein that functions as a recycling factor of the splicing machinery. Promotes... mehr
Produktinformationen "SART3, Recombinant, Human, aa600-900, His-Tag (Squamous Cell Carcinoma Antigen Recognized by T-Cells"
U6 snRNP-binding protein that functions as a recycling factor of the splicing machinery. Promotes the initial reassembly of U4 and U6 snRNPs following their ejection from the spliceosome during its maturation (PubMed:12032085). Also binds U6atac snRNPs and may function as a recycling factor for U4atac/U6atac spliceosomal snRNP, an initial step in the assembly of U12-type spliceosomal complex. The U12-type spliceosomal complex plays a role in the splicing of introns with non-canonical splice sites (PubMed:14749385). May also function as a substrate-targeting factor for deubiquitinases like USP4 and USP15. Recruits USP4 to ubiquitinated PRPF3 within the U4/U5/U6 tri-snRNP complex, promoting PRPF3 deubiquitination and thereby regulating the spliceosome U4/U5/U6 tri-snRNP spliceosomal complex disassembly (PubMed:20595234). May also recruit the deubiquitinase USP15 to histone H2B and mediate histone deubiquitination, thereby regulating gene expression and/or DNA repair (PubMed:24526689). May play a role in hematopoiesis probably through transcription regulation of specific genes including MYC (By similarity).By similarity4 Publications Regulates Tat transactivation activity through direct interaction. May be a cellular factor for HIV-1 gene expression and viral replication. Source: Recombinant protein corresponding to aa600-900 from human SART3, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~35.8kD, AA Sequence: QRKRARAEKKALKKKKKIRGPEKRGADEDDEKEWGDDEEEQPSKRRRVENSIPAAGETQNVEVAAGPAGKCAAVDVEPPSKQKEKAASLKRDMPKVLHDSSKDSITVFVSNLPYSMQEPDTKLRPLFEACGEVVQIRPIFSNRGDFRGYCYVEFKEEKSALQALEMDRKSVEGRPMFVSPCVDKSKNPDFKVFRYSTSLEKHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNRAGKPKGLAYVEYENESQASQAVMKMDGMTIKENIIKVAISNPPQRKVPEKPETRKAPGGPMLLP, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: SART-3, Tip110, p110 nuclear RNA-binding protein, Tat-interacting protein of 110 kDa, Squamous cell carcinoma antigen recognized by T-cells 3
Hersteller: United States Biological
Hersteller-Nr: 375210

Eigenschaften

Konjugat: No
MW: 35,8
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "SART3, Recombinant, Human, aa600-900, His-Tag (Squamous Cell Carcinoma Antigen Recognized by T-Cells"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen