SacIM, Recombinant, Streptomyces Achromogenes, aa1-390, His-SUMO-Tag (Modification Methylase SacI)

SacIM, Recombinant, Streptomyces Achromogenes, aa1-390, His-SUMO-Tag (Modification Methylase SacI)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375194.20 20 µg - -

3 - 19 Werktage*

511,00 €
375194.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
This methylase recognizes the double-stranded sequence GAGCTC, causes specific methylation on C-4... mehr
Produktinformationen "SacIM, Recombinant, Streptomyces Achromogenes, aa1-390, His-SUMO-Tag (Modification Methylase SacI)"
This methylase recognizes the double-stranded sequence GAGCTC, causes specific methylation on C-4 on both strands, and protects the DNA from cleavage by the SacI endonuclease. Source: Recombinant protein corresponding to aa1-390 from streptomyces achromogenes saclM, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~59.3kD, AA Sequence: MNHELPVISLFSGAGGLDCAIESCAEPPLVQDGSGSPLRVAVATDYEQTALDTLSANFPHTKTLCGDIQTIPTAELLEAGGLKPGDPTLVIGGPPCTPFSKSGFWIEEKRNSADPNASLLDEYVRVVRESKPEAFILENVQGLTYKTHQAQFDRLIAGLKDAGYNPTFRVLLAAEYGVPQLRRRVFVVGRRDGKAFHFPETTHSGESERDRVIDHTKIPFTSLREALAGLPDVPEAGEVVEGTYAELAAEVPPGQNYLWHTDRYGGRNEFKWRSRYWTFLLKADPDRPSTTLQAQPGPWVGPFHWENVKNANGEERARRFRVAEMKRIMTFPDEFVFTGVKREVQRQIGNPVPVELGKVVVRALMEQLGYLDSRGTTIPSQAGHEQLELI, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: sacIM, M.SacI, EC=2.1.1.37, Modification methylase SacI, Cytosine-specific methyltransferase SacI
Hersteller: United States Biological
Hersteller-Nr: 375194

Eigenschaften

Konjugat: No
MW: 59,3
Format: Highly Purified

Datenbank Information

UniProt ID : O31073 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "SacIM, Recombinant, Streptomyces Achromogenes, aa1-390, His-SUMO-Tag (Modification Methylase SacI)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen