S100A8, Recombinant, Mouse, aa2-89, His-SUMO-Tag (Protein S100-A8)

S100A8, Recombinant, Mouse, aa2-89, His-SUMO-Tag (Protein S100-A8)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375184.20 20 µg - -

3 - 19 Werktage*

455,00 €
375184.100 100 µg - -

3 - 19 Werktage*

713,00 €
S100A8 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of... mehr
Produktinformationen "S100A8, Recombinant, Mouse, aa2-89, His-SUMO-Tag (Protein S100-A8)"
S100A8 is a calcium- and zinc-binding protein which plays a prominent role in the regulation of inflammatory processes and immune response. It can induce neutrophil chemotaxis and adhesion. Predominantly found as calprotectin (S100A8/A9) which has a wide plethora of intra- and Extracellular domain functions. The intracellular functions include: facilitating leukocyte arachidonic acid trafficking and metabolism, modulation of the tubulin-dependent cytoskeleton during migration of phagocytes and activation of the neutrophilic NADPH-oxidase. Activates NADPH-oxidase by facilitating the enzyme complex assembly at the cell membrane, transferring arachidonic acid, an essential cofactor, to the enzyme complex and S100A8 contributes to the enzyme assembly by directly binding to NCF2/P67PHOX. The Extracellular domain functions involve proinfammatory, antimicrobial, oxidant-scavenging and apoptosis-inducing activities. Its proinflammatory activity includes recruitment of leukocytes, promotion of cytokine and chemokine production, and regulation of leukocyte adhesion and migration. Acts as an alarmin or a danger associated molecular pattern (DAMP) molecule and stimulates innate immune cells via binding to pattern recognition receptors such as Toll-like receptor 4 (TLR4) and receptor for advanced glycation endproducts (AGER). Binding to TLR4 and AGER activates the MAP-kinase and NF-kappa-B signaling pathways resulting in the amplification of the proinflammatory cascade. Has antimicrobial activity towards bacteria and fungi and exerts its antimicrobial activity probably via chelation of Zn2+ which is essential for microbial growth. Can induce cell death via autophagy and apoptosis and this occurs through the cross-talk of mitochondria and lysosomes via reactive oxygen species (ROS) and the process involves BNIP3. Can regulate neutrophil number and apoptosis by an anti-apoptotic effect, regulates cell survival via ITGAM/ITGB and TLR4 and a signaling mechanism involving MEK-ERK. Its role as an oxidant scavenger has a protective role in preventing exaggerated tissue damage by scavenging oxidants. The iNOS-S100A8/A9 transnitrosylase complex is proposed to direct selective inflammatory stimulus-dependent S-nitrosylation of multiple targets such as GAPDH, ANXA5, EZR, MSN and VIM by recognizing a [IL]-x-C-x-x-[DE] motif, S100A8 seems to contribute to S-nitrosylation site selectivity. Source: Recombinant protein corresponding to aa2-89 from mouse S100a8, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~26.2kD, AA Sequence: PSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQFVQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: p8, Caga, MRP-8, S100a8, Calgranulin-A, Protein S100-A8, Chemotactic cytokine CP-10, Pro-inflammatory S100 cytokine, S100 calcium-binding protein A8, Leukocyte L1 complex light chain, Migration inhibitory factor-related protein 8
Hersteller: United States Biological
Hersteller-Nr: 375184


Konjugat: No
MW: 26,2
Format: Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "S100A8, Recombinant, Mouse, aa2-89, His-SUMO-Tag (Protein S100-A8)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen