S-arrestin, Recombinant, Human, aa1-405, His-Tag (SAG)

S-arrestin, Recombinant, Human, aa1-405, His-Tag (SAG)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
370788.20 20 µg - -

3 - 19 Werktage*

621,00 €
370788.100 100 µg - -

3 - 19 Werktage*

947,00 €
 
Arrestin is one of the major proteins of the ros (retinal rod outer segments), it binds to... mehr
Produktinformationen "S-arrestin, Recombinant, Human, aa1-405, His-Tag (SAG)"
Arrestin is one of the major proteins of the ros (retinal rod outer segments), it binds to photoactivated-phosphorylated rhodopsin, thereby apparently preventing the transducin-mediated activation of phosphodiesterase. Source: Recombinant protein corresponding to aa1-405 from human SAG, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~47.1kD, AA Sequence: MAASGKTSKSEPNHVIFKKISRDKSVTIYLGNRDYIDHVSQVQPVDGVVLVDPDLVKGKKVYVTLTCAFRYGQEDIDVIGLTFRRDLYFSRVQVYPPVGAASTPTKLQESLLKKLGSNTYPFLLTFPDYLPCSVMLQPAPQDSGKSCGVDFEVKAFATDSTDAEEDKIPKKSSVRLLIRKVQHAPLEMGPQPRAEAAWQFFMSDKPLHLAVSLNKEIYFHGEPIPVTVTVTNNTEKTVKKIKAFVEQVANVVLYSSDYYVKPVAMEEAQEKVPPNSTLTKTLTLLPLLANNRERRGIALDGKIKHEDTNLASSTIIKEGIDRTVLGILVSYQIKVKLTVSGFLGELTSSEVATEVPFRLMHPQPEDPAKESYQDANLVFEEFARHNLKDAGEAEEGKRDKNDVDE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: SAG, S-AG, S-arrestin, 48 kDa protein, Retinal S-antigen, Rod photoreceptor arrestin
Hersteller: United States Biological
Hersteller-Nr: 370788

Eigenschaften

Konjugat: No
MW: 47,1
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "S-arrestin, Recombinant, Human, aa1-405, His-Tag (SAG)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen