RpsH, Recombinant, E. coli, aa2-130, His-Tag (30S Ribosomal Protein S8)

RpsH, Recombinant, E. coli, aa2-130, His-Tag (30S Ribosomal Protein S8)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375151.20 20 µg - -

3 - 19 Werktage*

511,00 €
375151.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
One of the primary rRNA binding proteins, it binds directly to 16S rRNA central domain where it... mehr
Produktinformationen "RpsH, Recombinant, E. coli, aa2-130, His-Tag (30S Ribosomal Protein S8)"
One of the primary rRNA binding proteins, it binds directly to 16S rRNA central domain where it helps coordinate assembly of the platform of the 30S subunit. Protein S8 is a translational repressor protein, it controls the translation of the spc operon by binding to its mRNA. Source: Recombinant protein corresponding to aa2-130 from E. coli rpsH, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~18.0kD, AA Sequence: SMQDPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKVEGDTKPELELTLKYFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGIAVVSTSKGVMTDRAARQAGLGGEIICYVA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: rpsH, b3306, 30S ribosomal protein S8, Small ribosomal subunit protein uS8
Hersteller: United States Biological
Hersteller-Nr: 375151

Eigenschaften

Konjugat: No
MW: 18
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "RpsH, Recombinant, E. coli, aa2-130, His-Tag (30S Ribosomal Protein S8)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen