ROR1, Recombinant, Human, aa30-391, His-Tag (Tyrosine-protein Kinase Transmembrane Receptor ROR1)

ROR1, Recombinant, Human, aa30-391, His-Tag (Tyrosine-protein Kinase Transmembrane Receptor ROR1)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375083.20 20 µg - -

3 - 19 Werktage*

416,00 €
375083.100 100 µg - -

3 - 19 Werktage*

637,00 €
 
Tyrosine-protein kinase receptor whose role is not yet clear.||Source:|Recombinant protein... mehr
Produktinformationen "ROR1, Recombinant, Human, aa30-391, His-Tag (Tyrosine-protein Kinase Transmembrane Receptor ROR1)"
Tyrosine-protein kinase receptor whose role is not yet clear. Source: Recombinant protein corresponding to aa30-391 from human ROR1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~42.5kD, AA Sequence: QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPAC, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: ROR1, NTRKR1, Neurotrophic tyrosine kinase, receptor-related 1, Inactive tyrosine-protein kinase transmembrane receptor ROR1
Hersteller: United States Biological
Hersteller-Nr: 375083

Eigenschaften

Konjugat: No
MW: 42,5
Format: Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "ROR1, Recombinant, Human, aa30-391, His-Tag (Tyrosine-protein Kinase Transmembrane Receptor ROR1)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen