Replication-associated Protein, Recombinant, African Cassava Mosaic Virus, aa1-358, His-SUMO-Tag (RE

Replication-associated Protein, Recombinant, African Cassava Mosaic Virus, aa1-358, His-SUMO-Tag (RE
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375039.20 20 µg - -

3 - 19 Werktage*

511,00 €
375039.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Essential for the replication of viral ssDNA. The closed circular ssDNA genome is first converted... mehr
Produktinformationen "Replication-associated Protein, Recombinant, African Cassava Mosaic Virus, aa1-358, His-SUMO-Tag (RE"
Essential for the replication of viral ssDNA. The closed circular ssDNA genome is first converted to a superhelical dsDNA. Rep binds a specific region at the genome origin of replication. It introduces an endonucleolytic nick within the conserved sequence 5'-TAATATTAC-3' in the intergenic region of the genome present in all giniviruses, thereby initiating the rolling circle replication (RCR). Following cleavage, binds covalently to the 5'-phosphate of DNA as a tyrosyl ester. The cleavage gives rise to a free 3'-OH that serves as a primer for the cellular DNA polymerase. The polymerase synthesizes the (+) strand DNA by rolling circle mechanism. After one round of replication, a Rep-catalyzed nucleotidyl transfer reaction releases a circular single-stranded virus genome, thereby terminating the replication. Displays origin-specific DNA cleavage, nucleotidyl transferase, ATPase and helicase activities. Source: Recombinant protein corresponding to aa1-358 from african cassava mosaic virus Replication-associated Protein, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~56.3kD, AA Sequence: MRTPRFRIQAKNVFLTYPKCSIPKEHLLSFIQTLSLQSNPKFIKICRELHQNGEPHLHALIQFEGKITITNNRLFDCVHPSCSTSFHPNIQGAKSSSDVKSYLDKDGDTVEWGQFQIDGRSARGGQQSANDAYAKALNSGSKSEALNVIRELVPKDFVLQFHNLNSNLDRIFQEPPAPYVSPFPCSSFDQVPVEIEEWVADNVRDSAARPWRPNSIVIEGDSRTGKTIWARSLGPHNYLCGHLDLSPKVFNNAAWYNVIDDVDPHYLKHFKEFMGSQRDWQSNTKYGKPVQIKGGIPTIFLCNPGPTSSYKEFLAEEKQEALKAWALKNAIFITLTEPLYSGSNQSHSQTSQEASHPA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: AC1, Rep, EC=2.7.7.-, Protein AL1, Protein AC1, EC=3.1.21.-, 40.4 kDa protein, Replication-associated protein
Hersteller: United States Biological
Hersteller-Nr: 375039

Eigenschaften

Konjugat: No
MW: 56,3
Format: Highly Purified

Datenbank Information

UniProt ID : P14982 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Replication-associated Protein, Recombinant, African Cassava Mosaic Virus, aa1-358, His-SUMO-Tag (RE"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen