RecR, Recombinant, Mycobacterium Tuberculosis, aa1-203, His-Tag (Recombination protein RecR)

RecR, Recombinant, Mycobacterium Tuberculosis, aa1-203, His-Tag (Recombination protein RecR)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
375022.20 20 µg - -

3 - 19 Werktage*

511,00 €
375022.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
May play a role in DNA repair. It seems to be involved in an RecBC-independent recombinational... mehr
Produktinformationen "RecR, Recombinant, Mycobacterium Tuberculosis, aa1-203, His-Tag (Recombination protein RecR)"
May play a role in DNA repair. It seems to be involved in an RecBC-independent recombinational process of DNA repair. It may act with RecF and RecO. Source: Recombinant protein corresponding to aa1-203 from mycobacterium tuberculosis recR, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~26.1kD, AA Sequence: MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPSDIDRLTGVLAKVRDGVRFCAVCGNVSDNERCRICSDIRRDASVVCIVEEPKDIQAVERTREFRGRYHVLGGALDPLSGIGPDQLRIRELLSRIGERVDDVDVTEVIIATDPNTEGEATATYLVRMLRDIPGLTVTRIASGLPMGGDLEFADELTLGRALAGRRVLA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: MRA_3752, Recombination protein RecR
Hersteller: United States Biological
Hersteller-Nr: 375022

Eigenschaften

Konjugat: No
MW: 26,1
Format: Highly Purified

Datenbank Information

KEGG ID : K06187 | Passende Produkte
UniProt ID : A5U941 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "RecR, Recombinant, Mycobacterium Tuberculosis, aa1-203, His-Tag (Recombination protein RecR)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen