PTTH, Recombinant, Bombyx mori, aa116-224, His-Tag (Prothoracicotropic Hormone)

PTTH is a brain secretory polypeptide of insects which stimulates the prothoracic glands to produce and release ecdysone, the steroid essential to insect development. Peptides P2K and P6K are presumed to be cleaved post-translationally and may play some unknown physiologically or developmentally important functions. Source: Recombinant protein corresponding to aa116-224 from bombyx mori Prothoracicotropic hormone, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~16.7kD, AA Sequence: GNIQVENQAIPDPPCTCKYKKEIEDLGENSVPRFIETRNCNKTQQPTCRPPYICKESLYSITILKRRETKSQESLEIPNELKYRWVAESHPVSVACLCTRDYQLRYNNN, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.