PTTH, Recombinant, Bombyx mori, aa116-224, His-Tag (Prothoracicotropic Hormone)

PTTH, Recombinant, Bombyx mori, aa116-224, His-Tag (Prothoracicotropic Hormone)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374942.20 20 µg - -

3 - 19 Werktage*

511,00 €
374942.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
PTTH is a brain secretory polypeptide of insects which stimulates the prothoracic glands to... mehr
Produktinformationen "PTTH, Recombinant, Bombyx mori, aa116-224, His-Tag (Prothoracicotropic Hormone)"
PTTH is a brain secretory polypeptide of insects which stimulates the prothoracic glands to produce and release ecdysone, the steroid essential to insect development. Peptides P2K and P6K are presumed to be cleaved post-translationally and may play some unknown physiologically or developmentally important functions. Source: Recombinant protein corresponding to aa116-224 from bombyx mori Prothoracicotropic hormone, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~16.7kD, AA Sequence: GNIQVENQAIPDPPCTCKYKKEIEDLGENSVPRFIETRNCNKTQQPTCRPPYICKESLYSITILKRRETKSQESLEIPNELKYRWVAESHPVSVACLCTRDYQLRYNNN, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Hersteller: United States Biological
Hersteller-Nr: 374942

Eigenschaften

Konjugat: No
Exprimiert in: E.coli
Ursprungsart: Bombyx Mori
MW: 16.7 kD
Reinheit: ?90% (SDS-PAGE)

Datenbank Information

UniProt ID : P17219 | Passende Produkte
Gene ID : GeneID 692767 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "PTTH, Recombinant, Bombyx mori, aa116-224, His-Tag (Prothoracicotropic Hormone)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen