PTPRZ1, Recombinant, Human, aa36-300, His-Tag (Receptor-Type Tyrosine-Protein Phosphatase zeta)

PTPRZ1, Recombinant, Human, aa36-300, His-Tag (Receptor-Type Tyrosine-Protein Phosphatase zeta)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374941.20 20 µg - -

3 - 19 Werktage*

416,00 €
374941.100 100 µg - -

3 - 19 Werktage*

637,00 €
 
Protein tyrosine phosphatase that negatively regulates oligodendrocyte precursor proliferation in... mehr
Produktinformationen "PTPRZ1, Recombinant, Human, aa36-300, His-Tag (Receptor-Type Tyrosine-Protein Phosphatase zeta)"
Protein tyrosine phosphatase that negatively regulates oligodendrocyte precursor proliferation in the embryonic spinal cord. Required for normal differentiation of the precursor cells into mature, fully myelinating oligodendrocytes. May play a role in protecting oligondendrocytes against apoptosis. May play a role in the establishment of contextual memory, probably via the dephosphorylation of proteins that are part of important signaling cascades. Source: Recombinant protein corresponding to aa36-300 from human PTPRZ1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~32.1kD, AA Sequence: IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: PTPRZ1, HTPZP2, R-PTP-zeta, R-PTP-zeta-2, Receptor-type tyrosine-protein phosphatase zeta, Protein-tyrosine phosphatase receptor type Z polypeptide 1, Protein-tyrosine phosphatase receptor type Z polypeptide 2
Hersteller: United States Biological
Hersteller-Nr: 374941

Eigenschaften

Konjugat: No
MW: 32,1
Format: Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "PTPRZ1, Recombinant, Human, aa36-300, His-Tag (Receptor-Type Tyrosine-Protein Phosphatase zeta)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen