Prss1, Recombinant, Rat, aa24-246, His-SUMO-Tag (Anionic Trypsin-1)

Prss1, Recombinant, Rat, aa24-246, His-SUMO-Tag (Anionic Trypsin-1)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374890.20 20 µg - -

3 - 19 Werktage*

455,00 €
374890.100 100 µg - -

3 - 19 Werktage*

713,00 €
 
Source:|Recombinant protein corresponding to aa24-246 from rat Prss1, fused to His-SUMO-Tag at... mehr
Produktinformationen "Prss1, Recombinant, Rat, aa24-246, His-SUMO-Tag (Anionic Trypsin-1)"
Source:, Recombinant protein corresponding to aa24-246 from rat Prss1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.6kD, AA Sequence: IVGGYTCPEHSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGDEQFINAAKIIKHPNYSSWTLNNDIMLIKLSSPVKLNARVAPVALPSACAPAGTQCLISGWGNTLSNGVNNPDLLQCVDAPVLSQADCEAAYPGEITSSMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCALPDNPGVYTKVCNFVGWIQDTIAAN, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Try1, Prss1, EC=3.4.21.4, Pretrypsinogen I, Serine protease 1, Anionic trypsin-1, Anionic trypsin I
Hersteller: United States Biological
Hersteller-Nr: 374890

Eigenschaften

Konjugat: No
MW: 39,6
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Prss1, Recombinant, Rat, aa24-246, His-SUMO-Tag (Anionic Trypsin-1)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen