Protein PrgI, Recombinant, Salmonella Typhimurium, aa1-80, His-SUMO-Tag (PrgI)

Required for invasion of epithelial cells. Source: Recombinant protein corresponding to aa1-80 from salmonella typhimurium prgl, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~24.9kD, AA Sequence: MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.