Protein PrgI, Recombinant, Salmonella Typhimurium, aa1-80, His-SUMO-Tag (PrgI)

Protein PrgI, Recombinant, Salmonella Typhimurium, aa1-80, His-SUMO-Tag (PrgI)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374880.20 20 µg - -

3 - 19 Werktage*

511,00 €
374880.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Required for invasion of epithelial cells.||Source:|Recombinant protein corresponding to aa1-80... mehr
Produktinformationen "Protein PrgI, Recombinant, Salmonella Typhimurium, aa1-80, His-SUMO-Tag (PrgI)"
Required for invasion of epithelial cells. Source: Recombinant protein corresponding to aa1-80 from salmonella typhimurium prgl, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~24.9kD, AA Sequence: MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: prgI, STM2873, Protein PrgI
Hersteller: United States Biological
Hersteller-Nr: 374880

Eigenschaften

Konjugat: No
MW: 24,9
Format: Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Protein PrgI, Recombinant, Salmonella Typhimurium, aa1-80, His-SUMO-Tag (PrgI)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen