Prnp, Recombinant, Rat, aa29-231, His-Tag (Major Prion Protein)

Prnp, Recombinant, Rat, aa29-231, His-Tag (Major Prion Protein)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374857.20 20 µg - -

3 - 19 Werktage*

455,00 €
374857.100 100 µg - -

3 - 19 Werktage*

713,00 €
 
May play a role in neuronal development and synaptic plasticity. May be required for neuronal... mehr
Produktinformationen "Prnp, Recombinant, Rat, aa29-231, His-Tag (Major Prion Protein)"
May play a role in neuronal development and synaptic plasticity. May be required for neuronal myelin sheath maintenance. May play a role in iron uptake and iron homeostasis. Soluble oligomers are toxic to cultured neuroblastoma cells and induce apoptosis (in vitro). Association with GPC1 (via its heparan sulfate chains) targets PRNP to lipid rafts. Also provides Cu2+ or ZN2+ for the ascorbate-mediated GPC1 deaminase degradation of its heparan sulfate side chains. Source: Recombinant protein corresponding to aa29-231 from rat Prnp, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~26.3kD, AA Sequence: GGWNTGGSRYPGQGSPGGNRYPPQSGGTWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWSQGGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMLHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCVTQYQKESQAYYDGRRS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Prn, PrP, Prnp, CD230, Major prion protein
Hersteller: United States Biological
Hersteller-Nr: 374857

Eigenschaften

Konjugat: No
MW: 26,3
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Prnp, Recombinant, Rat, aa29-231, His-Tag (Major Prion Protein)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen