PPX1, Recombinant, Saccharomyces Cerevisiae, aa1-397, His-Tag (Exopolyphosphatase)

PPX1, Recombinant, Saccharomyces Cerevisiae, aa1-397, His-Tag (Exopolyphosphatase)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374830.20 20 µg - -

3 - 19 Werktage*

511,00 €
374830.100 100 µg - -

3 - 19 Werktage*

818,00 €
 
Degradation of inorganic polyphosphates.||Source:|Recombinant protein corresponding to aa1-397... mehr
Produktinformationen "PPX1, Recombinant, Saccharomyces Cerevisiae, aa1-397, His-Tag (Exopolyphosphatase)"
Degradation of inorganic polyphosphates. Source: Recombinant protein corresponding to aa1-397 from saccharomyces cerevisiae PPX1, fused to His-Tag at N-terminal expressed in E. coli. Molecular Weight: ~49.1kD, AA Sequence: MSPLRKTVPEFLAHLKSLPISKIASNDVLTICVGNESADMDSIASAITYSYCQYIYNEGTYSEEKKKGSFIVPIIDIPREDLSLRRDVMYVLEKLKIKEEELFFIEDLKSLKQNVSQGTELNSYLVDNNDTPKNLKNYIDNVVGIIDHHFDLQKHLDAEPRIVKVSGSCSSLVFNYWYEKLQGDREVVMNIAPLLMGAILIDTSNMRRKVEESDKLAIERCQAVLSGAVNEVSAQGLEDSSEFYKEIKSRKNDIKGFSVSDILKKDYKQFNFQGKGHKGLEIGLSSIVKRMSWLFNEHGGEADFVNQCRRFQAERGLDVLVLLTSWRKAGDSHRELVILGDSNVVRELIERVSDKLQLQLFGGNLDGGVAMFKQLNVEATRKQVVPYLEEAYSNLEE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: PPX1, YHR201C, EC=3.6.1.11, ExopolyPase, Metaphosphatase, Exopolyphosphatase
Hersteller: United States Biological
Hersteller-Nr: 374830

Eigenschaften

Konjugat: No
MW: 49,1
Format: Purified

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "PPX1, Recombinant, Saccharomyces Cerevisiae, aa1-397, His-Tag (Exopolyphosphatase)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen