PolC, Recombinant, Cenarchaeum Symbiosum, aa287-832 (DNA Polymerase II Large Subunit)

PolC, Recombinant, Cenarchaeum Symbiosum, aa287-832 (DNA Polymerase II Large Subunit)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374787.20 20 µg - -

3 - 19 Werktage*

570,00 €
374787.100 100 µg - -

3 - 19 Werktage*

832,00 €
 
Possesses two activities: a DNA synthesis (polymerase) and an exonucleolytic activity that... mehr
Produktinformationen "PolC, Recombinant, Cenarchaeum Symbiosum, aa287-832 (DNA Polymerase II Large Subunit)"
Possesses two activities: a DNA synthesis (polymerase) and an exonucleolytic activity that degrades single-stranded DNA in the 3'- to 5'-direction. Has a template-primer preference which is characteristic of a replicative DNA polymerase. Source: Recombinant protein corresponding to aa287-832 from cenarchaeum symbiosum polC, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~59.0kD, AA Sequence: LAELKGAVQTGENKEDAAAKRMREVITGRSVLSMPNRLGGFRLRYGRACNTGYTSVGFHPAVAEILDHTIAVGTQVKIDIPGKGATVAFVDTIEAPTVRLAGGDVVKIRDVAHGIELKGSIERILHLGDMLISFGDFLENNAQLVPSGYVEEIWKMDMEAAGAAQGSPSSADEAVRISRELGVPLHPRYLYYWDQISHEELAMLLSPLDKGDAISYPAACKPVLEKLGVPHKAGPEGPVLEGDEARIFRELILDNPPGPDASAPVPELISRSSGITIRDKFSTSIGVRIGRPEKAAPRQMRPPTHCLFPVGGTGGPTNNLLKSAARPGFSADILSRRCPGCGEPSISIRCWACGERTAVERTCMQCGTDVDGEECERCGRPGLAHSRVEFPLKKMLVSAQEKTGVRAHDPLKGVKELAHQDRIAEPLEKGLIRQSRSLTVFKDGTVRFDATNSPMTHFKPSWIGTSAEKLRELGYETDVDGKKLEGPDQLVELRMQDIVIPLEGAKYLVSACGYIDAELDKLYGAPPFYKVPDLGGLIGHLVVGLA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Pol II, CENSYa_1827, DNA polymerase II large subunit, Exodeoxyribonuclease large subunit
Hersteller: United States Biological
Hersteller-Nr: 374787

Eigenschaften

Konjugat: No
MW: 59
Format: Purified

Datenbank Information

KEGG ID : K02322 | Passende Produkte
UniProt ID : A0RYM0 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "PolC, Recombinant, Cenarchaeum Symbiosum, aa287-832 (DNA Polymerase II Large Subunit)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen