Plbd2, Recombinant, Mouse, aa47-594, His-Tag (Putative Phospholipase B-like 2)

Plbd2, Recombinant, Mouse, aa47-594, His-Tag (Putative Phospholipase B-like 2)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374742.20 20 µg - -

3 - 19 Werktage*

455,00 €
374742.100 100 µg - -

3 - 19 Werktage*

711,00 €
 
Putative phospholipase.||Source:|Recombinant protein corresponding to aa47-594 from mouse PLBD2,... mehr
Produktinformationen "Plbd2, Recombinant, Mouse, aa47-594, His-Tag (Putative Phospholipase B-like 2)"
Putative phospholipase. Source: Recombinant protein corresponding to aa47-594 from mouse PLBD2, fused to 6X His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~63.9kD, Amino Acid Sequence: LPTLGPGWQRQNPDPPVSRTRSLLLDAASGQLRLEDGFHPDAVAWANLTNAIRETGWAYLDLSTNGRYNDSLQAYAAGVVEASVSEELIYMHWMNTVVNYCGPFEYEVGYCEKLKNFLEANLEWMQREMELNPDSPYWHQVRLTLLQLKGLEDSYEGRLTFPTGRFTIKPLGFLLLQISGDLEDLEPALNKTNTKPSLGSGSCSALIKLLPGGHDLLVAHNTWNSYQNMLRIIKKYRLQFREGPQEEYPLVAGNNLVFSSYPGTIFSGDDFYILGSGLVTLETTIGNKNPALWKYVQPQGCVLEWIRNVVANRLALDGATWADVFKRFNSGTYNNQWMIVDYKAFLPNGPSPGSRVLTILEQIPGMVVVADKTAELYKTTYWASYNIPYFETVFNASGLQALVAQYGDWFSYTKNPRAKIFQRDQSLVEDMDAMVRLMRYNDFLHDPLSLCEACNPKPNAENAISARSDLNPANGSYPFQALHQRAHGGIDVKVTSFTLAKYMSMLAASGPTWDQCPPFQWSKSPFHSMLHMGQPDLWMFSPIRVPWD, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Plbd2, EC=3.1.1.-
Hersteller: United States Biological
Hersteller-Nr: 374742

Eigenschaften

Konjugat: No
MW: 63,9
Format: Purified

Datenbank Information

UniProt ID : Q3TCN2 | Passende Produkte
Gene ID : GeneID 71772 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Plbd2, Recombinant, Mouse, aa47-594, His-Tag (Putative Phospholipase B-like 2)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen