PI3, Recombinant, Human, aa61-117, His-Tag (Elafin)

Neutrophil and pancreatic elastase-specific inhibitor of skin. It may prevent elastase-mediated tissue proteolysis. Source: Recombinant protein corresponding to aa61-117 from human Elafin, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~8.01kD, AA Sequence: AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.