PI3, Recombinant, Human, aa61-117, His-Tag (Elafin)

PI3, Recombinant, Human, aa61-117, His-Tag (Elafin)
NEU
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374705.20 20 µg - -

3 - 19 Werktage*

416,00 €
374705.100 100 µg - -

3 - 19 Werktage*

637,00 €
 
Neutrophil and pancreatic elastase-specific inhibitor of skin. It may prevent elastase-mediated... mehr
Produktinformationen "PI3, Recombinant, Human, aa61-117, His-Tag (Elafin)"
Neutrophil and pancreatic elastase-specific inhibitor of skin. It may prevent elastase-mediated tissue proteolysis. Source: Recombinant protein corresponding to aa61-117 from human Elafin, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~8.01kD, AA Sequence: AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: PI3, ESI, WAP3, PI-3, SKALP, Elafin, Peptidase inhibitor 3, Protease inhibitor WAP3, Elastase-specific inhibitor, Skin-derived antileukoproteinase, WAP four-disulfide core domain protein 14
Hersteller: United States Biological
Hersteller-Nr: 374705

Eigenschaften

Konjugat: No
MW: 8,01
Format: Purified

Datenbank Information

UniProt ID : P19957 | Passende Produkte
Gene ID : GeneID 5266 | Passende Produkte

Handhabung & Sicherheit

Lagerung: °C
Versand: °C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier folgen Informationen zur Produktreferenz. mehr
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "PI3, Recombinant, Human, aa61-117, His-Tag (Elafin)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen