PHIP (BD1), Recombinant, Human, aa1146-1287, GST-tag (Bromodomain Pleckstrin Homology Domain Interac

PHIP (BD1), Recombinant, Human, aa1146-1287, GST-tag (Bromodomain Pleckstrin Homology Domain Interac
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
298446.100 100 µg - -

3 - 19 Werktage*

916,00 €
 
PHIP is a bromodomain-containing protein that binds the pleckstrin homology (PH) domain of... mehr
Produktinformationen "PHIP (BD1), Recombinant, Human, aa1146-1287, GST-tag (Bromodomain Pleckstrin Homology Domain Interac"
PHIP is a bromodomain-containing protein that binds the pleckstrin homology (PH) domain of insulin receptor substrate-1 (IRS1), modulates insulin signaling, and plays a role in pancreatic beta cell growth and survival. It stimulates cell proliferation through regulation of cyclin transcription and has an anti-apoptotic activity through AKT1 phosphorylation and activation. Source: Recombinant protein corresponding to bromodomain 1, aa1146-1287, from human PHIP, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~43kD, AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI, DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK, VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV, CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSSLIYK, PLDGEWGTNPRDEECERIVAGINQLMTLDIASAFVAPVDLQAYPMYCTVVAYPTDLST, IKQRLENRFYRRVSSLMWEVRYIEHNTRTFNEPGSPIVKSAKFVTDLLLHFIKDQTCYNI, IPLYNSMKKKVLSDSEDEE, Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Schlagworte: PHIP, DCAF14, PH-interacting protein, IRS-1 PH domain-binding protein, WD repeat-containing protein 11, DDB1- and CUL4-associated factor 14
Hersteller: United States Biological
Hersteller-Nr: 298446

Eigenschaften

Konjugat: No
Wirt: E.coli
Spezies-Reaktivität: human
MW: 43 kD
Reinheit: ~71%
Format: Purified

Handhabung & Sicherheit

Lagerung: -80°C
Versand: -20°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "PHIP (BD1), Recombinant, Human, aa1146-1287, GST-tag (Bromodomain Pleckstrin Homology Domain Interac"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen