NfuA, Recombinant, Vibrio Vulnificus, aa1-194, His-Tag (Fe/S Biogenesis Protein NfuA)

NfuA, Recombinant, Vibrio Vulnificus, aa1-194, His-Tag (Fe/S Biogenesis Protein NfuA)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374411.20 20 µg - -

3 - 19 Werktage*

675,00 €
374411.100 100 µg - -

3 - 19 Werktage*

1.045,00 €
 
Involved in iron-sulfur cluster biogenesis. Binds a 4Fe-4S cluster, can transfer this cluster to... mehr
Produktinformationen "NfuA, Recombinant, Vibrio Vulnificus, aa1-194, His-Tag (Fe/S Biogenesis Protein NfuA)"
Involved in iron-sulfur cluster biogenesis. Binds a 4Fe-4S cluster, can transfer this cluster to apoproteins, and thereby intervenes in the maturation of Fe/S proteins. Could also act as a scaffold/chaperone for damaged Fe/S proteins. Source: Recombinant protein corresponding to aa1-194 from vibrio vulnificus nfuA, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~23kD, AA Sequence: MSNITITEAAQTHFANLLGQQPDGTNIRVFVVNPGTQNAECGVSYCPPEAVEATDTEIPYQSFSAYVDELSLPFLEDAEIDYVTDKMGSQLTLKAPNAKMRKVADDAPLLERVEYAIQTQVNPQLAGHGGHVKLMEITDAGVAIVAFGGGCNGCSMVDVTLKEGIEKELLQQFSGELTAVRDATEHDRGDHSYY, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: VV1_0864, Fe/S biogenesis protein NfuA
Hersteller: United States Biological
Hersteller-Nr: 374411

Eigenschaften

Konjugat: No
MW: 23
Format: Highly Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "NfuA, Recombinant, Vibrio Vulnificus, aa1-194, His-Tag (Fe/S Biogenesis Protein NfuA)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen