NDUFA3, Recombinant, Human, aa2-84, GST-Tag (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subu

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Source: Recombinant protein corresponding to aa2-84 from human NDUFA3, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~36.1kD, AA Sequence: AARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDDGNMPDVPSHPQDPQGPSLEWLKKL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.,