Myoglobin, Recombinant, Mouse, aa2-154, His-tag (Mb)

Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles. Source: Recombinant protein corresponding to aa2-154 from mouse Myoglobin, fused to His-tag at N-terminal, expressed in yeast. Molecular Weight: ~18.9kD, AA Sequence: GLSDGEWQLVLNVWGKVEADLAGHGQEVLIGLFKTHPETLDKFDKFKNLKSEEDMKGSEDLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEIIIEVLKKRHSGDFGADAQGAMSKALELFRNDIAAKYKELGFQG, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.