LUC7L3, Recombinant, Human, aa1-79, His-Tag (Luc7-like Protein 3)

LUC7L3, Recombinant, Human, aa1-79, His-Tag (Luc7-like Protein 3)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
374092.20 20 µg - -

3 - 19 Werktage*

511,00 €
374092.100 100 µg - -

3 - 19 Werktage*

773,00 €
 
Binds cAMP regulatory element DNA sequence. May play a role in RNA splicing.||Source:|Recombinant... mehr
Produktinformationen "LUC7L3, Recombinant, Human, aa1-79, His-Tag (Luc7-like Protein 3)"
Binds cAMP regulatory element DNA sequence. May play a role in RNA splicing. Source: Recombinant protein corresponding to aa1-79 from human LUC7L3, fused to His-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~13.3kD, AA Sequence: MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKV, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: Luc7A, CREAP1, LUC7L3, CREAP-1, Luc7-like protein 3, CRE-associated protein 1, cAMP regulatory element-associated protein 1, Okadaic acid-inducible phosphoprotein OA48-18, Cisplatin resistance-associated-overexpressed protein
Hersteller: United States Biological
Hersteller-Nr: 374092

Eigenschaften

Konjugat: No
MW: 13,3
Format: Highly Purified

Datenbank Information

UniProt ID : O95232 | Passende Produkte
Gene ID GeneID 51747 | Passende Produkte

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "LUC7L3, Recombinant, Human, aa1-79, His-Tag (Luc7-like Protein 3)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen