Leukocyte Surface CD47, Recombinant, Human, aa19-139, His-Tag (CD47)

Leukocyte Surface CD47, Recombinant, Human, aa19-139, His-Tag (CD47)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
516811.10 10 µg - -

3 - 19 Werktage*

386,00 €
516811.50 50 µg - -

3 - 19 Werktage*

682,00 €
 
Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in... mehr
Produktinformationen "Leukocyte Surface CD47, Recombinant, Human, aa19-139, His-Tag (CD47)"
Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus (By similarity). Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection. Source: Recombinant partial protein corresponding to aa19-139 of human Leukocyte Surface CD47, fused to His-Tag at C-terminal, expressed in mammalian cell. Molecular Weight: ~14.76kD, Biological Activity: The ED50 as determined by its ability to bind human SIRPA in functional ELISA is less than 20ug/ml. Endotoxin: <1EU/ug (LAL). AA Sequence: QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP, Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile buffer or ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: IAP, MER6, CD47, Protein MER6, Integrin-associated protein, Leukocyte surface antigen CD47, Antigenic surface determinant protein OA3
Hersteller: United States Biological
Hersteller-Nr: 516811

Eigenschaften

Konjugat: No
Wirt: Mammalian cells
Spezies-Reaktivität: human
MW: 14.76 kD
Reinheit: >=95% (SDS-PAGE)
Format: Lyophilized

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Leukocyte Surface CD47, Recombinant, Human, aa19-139, His-Tag (CD47)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen