LepB, Recombinant, Mycobacterium Tuberculosis, aa88-294, His-Tag (Signal Peptidase I)

Source:, Recombinant protein corresponding to aa88-294 from mycobacterium tuberculosis lepB, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~24.6kD, AA Sequence: RPYLIPSESMEPTLHGCSTCVGDRIMVDKLSYRFGSPQPGDVIVFRGPPSWNVGYKSIRSHNVAVRWVQNALSFIGFVPPDENDLVKRVIAVGGQTVQCRSDTGLTVNGRPLKEPYLDPATMMADPSIYPCLGSEFGPVTVPPGRVWVMGDNRTHSADSRAHCPLLCTDDPLPGTVPVANVIGKARLIVWPPSRWGVVRSVNPQQGR, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.