LAMA5, Recombinant, Human, aa3401-3692, His-SUMO-Tag (Laminin Subunit alpha-5)

LAMA5, Recombinant, Human, aa3401-3692, His-SUMO-Tag (Laminin Subunit alpha-5)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
373980.20 20 µg - -

3 - 19 Werktage*

511,00 €
373980.100 100 µg - -

3 - 19 Werktage*

773,00 €
 
Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment,... mehr
Produktinformationen "LAMA5, Recombinant, Human, aa3401-3692, His-SUMO-Tag (Laminin Subunit alpha-5)"
Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other Extracellular domain matrix components. Source: Recombinant protein corresponding to aa3401-3692 from human LAMA5, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~47.1kD, AA Sequence: FVAQMEGLGTRLRAQSRQRSRPGRWHKVSVRWEKNRILLVTDGARAWSQEGPHRQHQGAEHPQPHTLFVGGLPASSHSSKLPVTVGFSGCVKRLRLHGRPLGAPTRMAGVTPCILGPLEAGLFFPGSGGVITLDLPGATLPDVGLELEVRPLAVTGLIFHLGQARTPPYLQLQVTEKQVLLRADDGAGEFSTSVTRPSVLCDGQWHRLAVMKSGNVLRLEVDAQSNHTVGPLLAAAAGAPAPLYLGGLPEPMAVQPWPPAYCGCMRRLAVNRSPVAMTRSVEVHGAVGASGC, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: LAMA5, KIAA0533, Laminin subunit alpha-5, Laminin-11 subunit alpha, Laminin-15 subunit alpha, Laminin-10 subunit alpha
Hersteller: United States Biological
Hersteller-Nr: 373980

Eigenschaften

Konjugat: No
MW: 47,1
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "LAMA5, Recombinant, Human, aa3401-3692, His-SUMO-Tag (Laminin Subunit alpha-5)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen