Klk8, Recombinant, Mouse, aa33-260, His-Tag (Kallikrein-8)

Klk8, Recombinant, Mouse, aa33-260, His-Tag (Kallikrein-8)
Artikelnummer Größe Datenblatt Manual SDB Lieferzeit Menge Preis
373936.20 20 µg - -

3 - 19 Werktage*

537,00 €
373936.100 100 µg - -

3 - 19 Werktage*

834,00 €
 
Serine protease which is capable of degrading a number of proteins such as casein, fibrinogen,... mehr
Produktinformationen "Klk8, Recombinant, Mouse, aa33-260, His-Tag (Kallikrein-8)"
Serine protease which is capable of degrading a number of proteins such as casein, fibrinogen, kininogen, fibronectin and collagen type IV. Also cleaves L1CAM in response to increased neural activity. Induces neurite outgrowth and fasciculation of cultured hippocampal neurons. Plays a role in the formation and maturation of orphan and small synaptic boutons in the Schaffer-collateral pathway, regulates Schaffer-collateral long-term potentiation in the hippocampus and is required for memory acquisition and synaptic plasticity. Involved in skin desquamation and keratinocyte proliferation. Plays a role in the secondary phase of pathogenesis following spinal cord injury. Source: Recombinant protein corresponding to aa33-260 from mouse Klk8, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~27.1kD, AA Sequence: ILEGRECIPHSQPWQAALFQGERLICGGVLVGDRWVLTAAHCKKQKYSVRLGDHSLQSRDQPEQEIQVAQSIQHPCYNNSNPEDHSHDIMLIRLQNSANLGDKVKPVQLANLCPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQNKCERAYPGKITEGMVCAGSSNGADTCQGDSGGPLVCDGMLQGITSWGSDPCGKPEKPGVYTKICRYTTWIKKTMDNRD, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Schlagworte: NP, mK8, Klk8, Nrpn, Neuropsin, Kallikrein-8, EC=3.4.21.118, Serine protease 19
Hersteller: United States Biological
Hersteller-Nr: 373936

Eigenschaften

Konjugat: No
MW: 27,1
Format: Purified

Handhabung & Sicherheit

Lagerung: -20°C
Versand: +4°C (International: °C)
Achtung
Nur für Forschungszwecke und Laboruntersuchungen: Nicht für die Anwendung im oder am Menschen!
Hier kriegen Sie ein Zertifikat
oder , um Analysenzertifikate anzufordern.
Bewertungen lesen, schreiben und diskutieren... mehr
Kundenbewertungen für "Klk8, Recombinant, Mouse, aa33-260, His-Tag (Kallikrein-8)"
Bewertung schreiben
oder , um eine Produktbewertung abzugeben.
Zuletzt angesehen